KEGG   Bacillus subtilis subsp. subtilis 168: BSU26670Help
Entry
BSU26670          CDS       T00010                                 

Gene name
gltR
Definition
(RefSeq) LysR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
2725837..2726727
Genome map
AA seq 296 aa AA seqDB search
MNIQLLQVFLTTAREGSISKAALTLNYAQSNVTNKIQQLENDLQTKLFYRHSRGITLTPP
GQILVSYSEKILHTIEEARAAMGESSAPSGPLRIGSMETTAAVWLPQLLAHYNNLYPNVD
LNLVTGPTEQQIQAVLHYELNGAFISGPIEHPDLVQEKVLDEEMVLVTSASHPVISSIQD
VQTQTMLVFRKGCSYRAKLNHILQEEGLLPIKLMEFGILEAIIGCVSAGLGISLLPRSII
ASHEKEGRIRSHTISDKYSFVSTMFIRRKDTLITPALSAFLTHMRDHFQIKRPDQS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcagttgttacaggtttttctcactactgctcgtgaaggcagtatttccaag
gctgctctgactttaaattatgcacaatcgaatgtaacgaataagatacaacaactagaa
aacgatttacagacaaaattattctatcgtcatagtcgaggaatcacacttactccccca
gggcaaattcttgtttcttactcagagaaaattctacatactattgaagaagctagagca
gccatgggcgaatcatccgcgccttctgggccactgcgtataggatcaatggaaacaaca
gctgcagtttggcttcctcaactccttgcacattataataacctctatccaaatgttgat
ttgaacctagtaaccggccctacggaacaacaaatacaagcagttttacattatgagtta
aacggcgcttttatttcagggcctattgaacaccctgatttagttcaagaaaaggtattg
gatgaagagatggttcttgttacaagtgcttcacaccctgtgatttcttccattcaggat
gttcaaacacaaacaatgcttgtattccgtaaaggatgctcatacagagcaaagctcaat
catatcctgcaagaagaaggtttattacctataaaattaatggaatttggcatacttgaa
gcgatcattggctgtgtaagcgccggcttggggatttcactgctgcctcgttcaatcatt
gcttcgcatgaaaaagaaggccgcatccgcagccacactatctctgacaaatattctttt
gtatcaactatgtttataaggcggaaagacactttaattacccctgctttatctgctttt
ttaacgcatatgagggatcattttcagataaagaggccagatcaatcgtaa

DBGET integrated database retrieval system