KEGG   Bacillus subtilis subsp. subtilis 168: BSU26700Help
Entry
BSU26700          CDS       T00010                                 

Gene name
azlD
Definition
(RefSeq) branched-chain amino acid transport protein AzlD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2728647..2728979)
Genome map
AA seq 110 aa AA seqDB search
MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGKVLPSAVIGLLVIYCL
KDVSLLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMVLVQLVF
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgactatgacgcagcaaatgatcaccatcgcaatggtcgtgcttggaacaatg
ctgacacggttccttccattcatgattttcccgtctggcaaaccgacaccgaaatatgta
cagtatcttggtaaagtgctgccatcagcggtaatcgggcttttagtcatttattgtttg
aaagatgtgagtctactttctggaagtcatggcattcctgaattggttggagcagctgct
gttgtactgcttcacttgtggaagaaaaatatgcttctttccatagcggggggaaccgtt
gtttatatggttttggtgcaattggttttttaa

DBGET integrated database retrieval system