KEGG   Bacillus subtilis subsp. subtilis 168: BSU27740Help
Entry
BSU27740          CDS       T00010                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BSU27740 (ruvA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU27740 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2836165..2836770)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKERSQETIFTYHHIREDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIQAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIENLFNHEERLEKQTAETALEEALEALRVLGYAEKEIKKVLPHL
KEEIGLTTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttgttaaagggacgattgattatgtatctccccaatatattgtcatagag
aacggcggcatcggctatcagattttcacgccgaatccgtttatatataaggagagaagc
caagaaacgatttttacataccatcatatcagagaggatgctttttcgctttatggtttt
tcaacaagagaggagaaggcgctctttacaaagctgttaaacgtgaccggaattggcccg
aaaggagcacttgccatcttgggctcgggtgatcccggagcggtcatccaagcaattgaa
aatgaagatgaagcttttttggtcaagtttcctggagtaggaaagaaaaccgcacgccag
attattctagatttaaaaggaaagctggcagatgttgtgcctgaaatgattgaaaatctg
tttaatcatgaagaaaggcttgaaaagcaaacagcggaaacggctcttgaagaagcactt
gaagccctcagggttctcggatatgctgaaaaagaaatcaaaaaggtgcttcctcacctt
aaagaagaaattgggctgacaacagaccaatatgtgaaaaaagcattacaaaaactatta
aagtaa

DBGET integrated database retrieval system