KEGG   Bacillus subtilis subsp. subtilis 168: BSU27980Help
Entry
BSU27980          CDS       T00010                                 

Gene name
spoIVFA
Definition
(RefSeq) stage IV sporulation protein FA
  KO
K06401  
stage IV sporulation protein FA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(2856832..2857626)
Genome map
AA seq 264 aa AA seqDB search
MSHRADEIRKRLEKRRKQLSGSKRFSTQTVSEKQKPPSWVMVTDQEKHGTLPVYEDNMPT
FNGKHPLVKTDSIILKCLLSACLVLVSAIAYKTNIGPVSQIKPAVAKTFETEFQFASASH
WFETKFGNPLAFLAPEHKNKEQQIEVGKDLIAPASGKVQQDFQDNGEGIKVETSSDKIDS
VKEGYVVEVSKDSQTGLTVKVQHADNTYSIYGELKDVDVALYDFVDKGKKLGSIKLDDHN
KGVYYFAMKDGDKFIDPIQVISFE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacagagcagatgaaatcagaaaacgattagagaaaagaagaaagcagctttcc
ggctcaaaacgtttctctactcagacagtttctgaaaagcagaaacccccgtcctgggtg
atggtaacggatcaggaaaagcatggaacacttccggtctacgaagataacatgccaaca
ttcaacggaaaacacccattggtgaaaacagattcaattatcctgaaatgtcttctgtcg
gcctgccttgttctcgtttcagctatagcctataaaacaaacattggacccgtcagtcag
attaaacccgccgtagccaaaacctttgaaactgaatttcaatttgcttcagcaagccat
tggttcgaaaccaaattcggaaatccgcttgctttcctggctcctgaacacaaaaataag
gaacagcagattgaagtaggcaaagatctgatcgcgcctgcatccgggaaagtacagcag
gattttcaggacaatggggaaggaattaaagtcgaaacaagcagtgataagattgatagc
gtaaaagaaggctatgtggttgaagtcagcaaagacagccaaacgggactgacggttaag
gtgcagcatgctgacaacacctatagtatctatggcgagctcaaagatgtggatgttgct
ttatatgattttgtggataaaggcaaaaagctcggttcgattaagcttgatgatcataat
aaaggggtctattattttgccatgaaagacggcgataaatttattgatccgattcaggtg
atttcatttgaataa

DBGET integrated database retrieval system