KEGG   Bacillus subtilis subsp. subtilis 168: BSU28130Help
Entry
BSU28130          CDS       T00010                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28130 (hemB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BSU28130 (hemB)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU28130 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF2493
Motif
Other DBs
NCBI-GeneID: 936972
NCBI-ProteinID: NP_390691
Pasteur: BG10344
BSORF: BG10344
UniProt: P30950
Position
complement(2874202..2875176)
Genome map
AA seq 324 aa AA seqDB search
MSQSFNRHRRLRTSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVHHVSLDL
LKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKEHFPEMVVVADTC
LCEYTDHGHCGLVKDGVILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALD
KEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEE
GADFLIVKPSLSYMDIMRDVKNEFTLPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILT
SMKRAGADLIITYHAKDAAKWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcatttaatagacaccgccgcctgcggacatcaaaagcaatgagagaaatg
gtaaaggaaacacgtttgcatccatcagattttatatatccgatttttgtcgttgaaggg
ctggaaggcaaaaaagctgttccgtcaatgcctgatgttcaccatgtatcattagattta
ttgaaggatgaagtagcggagctggtcaaactgggcattcaatctgttatcgtgttcggc
atcccggaagaaaaagatgattgcggaacacaagcgtaccatgatcacggaattgtccaa
aaagccatcacagaaattaaagaacacttccctgaaatggttgttgtcgctgacacgtgc
ctgtgcgaatatacagaccacggccattgcggacttgtcaaagacggagtcattctcaat
gatgaatcgctggagcttttggcgcagacagctgtcagccaagcgaaagcaggtgcggat
atcattgcgccatcaaacatgatggacggatttgttacagtgatcagagaagcacttgat
aaagaaggattcgtcaatattcccatcatgtcttacgctgttaaatattcaagtgagttt
tacggtccgttccgtgatgcagcaaacagcacaccgcaattcggagaccgcaaaacatat
cagatggaccctgccaaccgtatggaggcactccgcgaagcacaatcagatgttgaggaa
ggcgcggactttttgattgtcaaaccttcgctttcttatatggatatcatgcgtgacgta
aaaaatgagtttactttgccgctcgtcgcttataatgtaagcggagagtattcaatggtg
aaggctgcagcgcagaacggctggatcaaagaaaaagaaattgtgttggaaattttgaca
agcatgaagcgcgcgggtgccgacctgattattacgtatcatgcgaaagacgcagcgaaa
tggcttgcggagtaa

DBGET integrated database retrieval system