KEGG   Bacillus subtilis subsp. subtilis 168: BSU29190Help
Entry
BSU29190          CDS       T00010                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSU29190 (pfkA)
   01230 Biosynthesis of amino acids
    BSU29190 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU29190 (pfkA)
   00030 Pentose phosphate pathway
    BSU29190 (pfkA)
   00051 Fructose and mannose metabolism
    BSU29190 (pfkA)
   00052 Galactose metabolism
    BSU29190 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BSU29190 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BSU29190 (pfkA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BSU29190 (pfkA)
Protein phosphatases and associated proteins [BR:bsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BSU29190 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2986588..2987547)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggagggactaagctttatacggcgagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagcaaacttgaagaagcttggtattgaaggccttgttgttatc
ggtggagacggttcctatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggcgcagaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttggcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactt
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system