KEGG   Bacillus subtilis subsp. subtilis 168: BSU29680Help
Entry
BSU29680          CDS       T00010                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bsu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bsu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bsu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3038213..3039931)
Genome map
AA seq 572 aa AA seqDB search
MNLKALPAIEGDHNLKNYEETYRHFDWAEAEKHFSWHETGKLNAAYEAIDRHAESFRKNK
VALYYKDAKRDEKYTFKEMKEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLENSEAKVVVTTPELLERIPVDKLPHLQHVFVVGGEAES
GTNIINYDEAAKQESTRLDIEWMDKKDGFLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEEDIYWCTADPGWVTGTVYGIFAPWLNGATNVIVGGRFSPESWYGTIEQLGVNVW
YSAPTAFRMLMGAGDEMAAKYDLTSLRHVLSVGEPLNPEVIRWGHKVFNKRIHDTWWMTE
TGSQLICNYPCMDIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMHTIW
NNPEKYESYFMPGGWYVSGDSAYMDEEGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGFEPSDKLKEEIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgaaagcgttaccagcaatagagggggatcataacttaaaaaactatgaagaa
acgtaccggcattttgattgggccgaggcagagaaacatttctcttggcatgagacaggg
aaactgaatgcggcgtatgaagcgattgaccgccatgccgaatcgtttcgaaaaaacaaa
gtagcgctttattataaagacgcaaaaagggatgaaaaatacacatttaaagaaatgaag
gaagaatcaaacagagccgggaatgtgctgagacggtatggaaatgtggaaaaaggggac
cgcgtttttatttttatgccgagatcacccgagctttattttattatgcttggcgcaatc
aaaattggcgccatcgccgggccgctgttcgaagcatttatggagggagcggtgaaagac
cggcttgaaaacagtgaggcaaaggttgttgtcacaacgcctgagctgctggagagaata
ccggtagacaaactgcctcacttgcagcatgtcttcgtagtcgggggagaggctgagagc
ggcacgaatatcatcaattatgatgaagcagcgaaacaggaaagcacaagattggatatc
gaatggatggataaaaaagacggctttctgcttcactatacatcaggttccactggtacg
ccaaagggcgtgttgcatgtccatgaagcgatgattcagcaatatcaaacaggaaagtgg
gtccttgatttaaaggaagaagacatttattggtgcacggctgatccaggctgggtgaca
ggtacggtatacggcatttttgcaccgtggctgaacggagcgacaaatgtcatcgtcggc
ggacgtttcagcccggaaagctggtatggaacgattgaacagcttggcgtcaatgtctgg
tacagcgcgccgacagcttttcggatgctgatgggagcgggagatgaaatggctgcgaaa
tatgatctaacttcactccggcatgtgctcagtgtcggtgagccgctaaatccggaagtc
atcagatggggacataaagtttttaacaaacgaatccatgatacctggtggatgaccgaa
acgggcagtcagctcatctgcaactatccttgcatggatattaaaccgggttcaatgggt
aagccgattccaggagtggaggcagcgatcgttgacaatcaaggcaacgagctaccgccg
taccgaatgggcaatctcgccatcaaaaagggctggccttccatgatgcataccatttgg
aataaccctgaaaagtatgaatcgtatttcatgccgggcggctggtatgtgtctggggat
tctgcttacatggatgaagagggatacttttggttccaaggcagagttgatgacgtcatc
atgacctccggtgagcgcgtcggcccatttgaagtggaaagcaagcttgtcgaacatccg
gctattgcagaagcaggcgttatcggaaagcctgacccggtgcgtggagaaatcattaaa
gcctttattgcactcagggaaggatttgagccgtctgataaactgaaagaagagatccgc
ctatttgtaaagcagggtcttgcagcccatgcggctccgcgtgagatcgaatttaaagat
aagcttccgaaaaccagaagcggaaagatcatgaggcgcgtgctgaaggcatgggagctt
aatctgccggctggagatctgtcaacaatggaggattaa

DBGET integrated database retrieval system