KEGG   Bacillus subtilis subsp. subtilis 168: BSU29690Help
Entry
BSU29690          CDS       T00010                                 

Gene name
acuA
Definition
(RefSeq) acetoin utilization protein AcuA
  KO
K04766  
acetoin utilization protein AcuA [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU29690 (acuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
3040092..3040724
Genome map
AA seq 210 aa AA seqDB search
MEHHKTYHSANIKTATGSLLIEGPVSPEDLAGYEFHKDLTAFRPPREQHEALVDIAGLPE
GRIIIARDGRTIVGYVTYLYPDPLERWSEGNMEDLIELGAIEVAPDYRGCAVGKTLLTVS
MMDEQMENYIVMTTEYYWHWDLKGMKKDVWEYRKIMEKMMNAGGLVWFATDEPEISSHPA
NCLMARIGKNVSQESIEQFDRLRFYHRYMY
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggaacatcataaaacataccattcagcaaacatcaaaacagcaaccggctctttactg
atagaagggcctgtctctccagaggatttggcaggttatgagtttcataaagatttaacc
gcatttcgcccgcctcgcgagcagcatgaagcgctagtcgacattgcaggccttcccgaa
gggcgcattattattgccagagacggccgaaccattgtcggctatgtcacgtatttatat
cctgacccgctcgaaagatggtctgaaggaaatatggaggatttgattgagctcggagcc
atcgaagtagcgccggactatcggggatgcgctgtcggaaagacgctcctgaccgtcagc
atgatggatgaacaaatggaaaactacattgtgatgacgacagaatattactggcattgg
gatttaaaagggatgaaaaaagatgtgtgggaatacagaaagatcatggaaaagatgatg
aatgcaggcggattggtctggtttgcaacggatgagccggagatcagctcccaccctgca
aactgtctgatggcccgcattggaaaaaacgtcagccaagaatcaattgagcaatttgac
aggctccgtttttatcatcgttatatgtattaa

DBGET integrated database retrieval system