KEGG   Bacillus subtilis subsp. subtilis 168: BSU29980Help
Entry
BSU29980          CDS       T00010                                 

Gene name
ytjP
Definition
dipeptidase YtjP
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsu01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bsu00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3067420..3068811)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLELGEKEGFT
TKNLDGFAGHIEWGEGDDIIGVLCHVDVVPPGDGWTSDPFSAEIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRMIIGTDEESDWRCVEHYFKHEEMPTMGFAPDADFPII
NAEKGIIDASLLIPHRPNQAEPKAVLVSFQSGLRLNMVPDAAEAVIEGPKNEEILSSFKD
MLRTTDQKGEAAIENGQLILRMYGLSCHAMEPNNGINAGILLCEFLQQTELDDAGKRFVQ
VVTDKFSGDTRGKKLDIDCEDEISGELTLNVGTLRYKEGQGGELGINIRYPVTAESKVIR
DTFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaaaaaagaggatttaattcgtgatacacaggaa
tttttgagaatcaacagtgtcatggacgaaacaaccgccggacccggtaaaccgtttgga
gaaggggtaaatgccagcctgacttcattgctggagcttggagaaaaagaaggctttaca
acaaaaaatcttgacggcttcgcaggtcatattgaatggggggagggcgatgacattatc
ggcgtactttgccatgttgacgtcgtgccgccgggagatgggtggacgagtgatccattt
tcagctgaaatccgcaacggacggatttatgcaaggggcgccattgatgacaaaggcccg
acaatggcggcattctacgcgctgaaaatcgtgaaagacatgaatttgcccctgtccaag
cgagtcagaatgattatcggaacagatgaagaaagtgattggagatgcgtagagcattat
ttcaagcatgaagaaatgccaacaatgggctttgcgcctgacgccgattttccgatcatt
aatgcggaaaaagggatcatcgatgcttctttacttattccgcaccgcccaaatcaagct
gaaccaaaggcagtgcttgtctcgtttcaatcaggccttcgcttaaacatggtgcccgac
gctgcggaagctgtcattgaagggccgaaaaatgaagagattctgtcttcatttaaagac
atgctccgcacgacggaccaaaaaggggaagctgcaatagagaacggacagctcattttg
cgtatgtacggtctttcctgccatgcgatggaaccgaacaatgggatcaatgccggcatt
ttattgtgcgaatttctccagcagactgagcttgacgatgcaggaaagcggtttgtgcaa
gttgtgacagataagttctcaggtgatacaagaggaaaaaaactggacatcgactgtgag
gatgaaatcagcggagagctgacattaaatgtcggaacactgcgctataaagaagggcaa
ggaggcgagctcgggatcaatatccgctatcctgtgacagcagaaagcaaagtgatccgc
gatacattcgaaagcgcatctgaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtccgcagatcatccgttagtcaaaaccctgcaaaaggtttatgaaggccagctg
ggtaaaaaagctgatttaatctcaatcggcggggggacttatgcgagatccttaaaagcc
ggtgtcgcgttcggcccgctgttccccggacgccctgacagcgcacaccaaaaggatgaa
tatatcgaaattgatgacctgctgagatcgacagcgttatatgctcaggccatttacgag
cttgcaaaataa

DBGET integrated database retrieval system