KEGG   Bacillus subtilis subsp. subtilis 168: BSU30080Help
Entry
BSU30080          CDS       T00010                                 

Gene name
yteV
Definition
(RefSeq) sporulation protein cse60
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_Cse60
Motif
Other DBs
NCBI-GeneID: 937278
NCBI-ProteinID: NP_390886
Pasteur: BG12339
BSORF: BG12339
UniProt: P94496
Position
complement(3078393..3078575)
Genome map
AA seq 60 aa AA seqDB search
MLKVAVFDEEHEKDLQTEINSFLKGISEEQLIDIKYTVSAACDPDGEQLYCFSALILYRK
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggtagcggtatttgatgaagagcatgaaaaagacttacaaacggaaatcaat
tcatttttaaaagggatatcggaggagcagctgatagatatcaaatatacggtttcggcg
gcgtgcgacccagacggcgagcagctttactgtttttccgcccttattttatatcgcaaa
taa

DBGET integrated database retrieval system