KEGG   Bacillus subtilis subsp. subtilis 168: BSU30420Help
Entry
BSU30420          CDS       T00010                                 

Gene name
ytrE
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K16920  
acetoin utilization transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
ABC transporters
Module
Acetoin utilization transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU30420 (ytrE)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Acetoin utilization transporter [MD:M00584] [OT]
    BSU30420 (ytrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3115279..3115974)
Genome map
AA seq 231 aa AA seqDB search
MIDVQHIDHSFTIGKKGRENEVPVLKDVSLSVAKGEIACIVGRSGSGKSTLLNLISGYIS
PTKGRIVINGTDVTGFNEKEWAQFRLDHFGFIFQSFQLIPGLTTYENVEMPLALKGIKPS
ERKQKVQDMLKRVGLENHAAHYPNELSGGQQQRVSIARALILNPSIILADEPTGSLDSET
EHEVLELIQQLNRERGITFVIITHDDEVASIGHSKFQLHDGVLKGGITVEV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgttcagcatatcgaccattctttcacgatcggaaaaaagggccgtgagaat
gaagttccagtattgaaggatgtttcattgagcgtggcgaaaggggaaatcgcctgcatt
gtcggacgaagcggctcagggaaatcaacgcttttgaatttaatttccggctacatatcg
ccgacaaaagggcggattgtcattaatggcactgatgttacggggtttaatgaaaaggaa
tgggcgcaatttcggcttgaccatttcgggtttatttttcagagctttcagctcatcccg
ggtttaacgacgtatgagaatgtggaaatgccgctggcgttaaaaggaatcaagccatct
gagcggaagcaaaaggtgcaggacatgctgaaacgcgtcggtctggaaaaccacgccgct
cattatccgaatgaactgtcaggcggccagcagcagcgtgtcagtattgctcgagcattg
attttaaatccttcgattatcttagcggatgagccgacgggaagccttgattcagaaacg
gaacatgaagtgctggaattgatccagcagctgaatcgtgagcgtggcattacatttgtg
atcattactcacgatgatgaagtcgcttctatcggacattcaaaatttcagcttcatgat
ggtgtgctaaaaggaggaattaccgttgaggtttaa

DBGET integrated database retrieval system