KEGG   Bacillus subtilis subsp. subtilis 168: BSU30980Help
Entry
BSU30980          CDS       T00010                                 

Gene name
glgB
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme GlgB
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU30980 (glgB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BSU30980 (glgB)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU30980 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase DUF2502
Motif
Other DBs
NCBI-GeneID: 937993
NCBI-ProteinID: NP_390976
Pasteur: BG10907
BSORF: BG10907
UniProt: P39118
Position
complement(3169763..3171646)
Genome map
AA seq 627 aa AA seqDB search
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSW
SGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASL
TYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYI
KKHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDW
VPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEF
YHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQV
TGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHD
EVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDW
FLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGQKH
GEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHK
PCYITMTIPPYGISILRAVKKRGEIKR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccagcccgacagcacatgatgtttatctttttcacgaaggcagtctgttt
aaaagctatcagctgtttggctcgcattaccgcgagctgaatggcaaaagcggatatgaa
ttctgtgtgtgggcgcctcatgcgtcggaagtacgagtggctggagattttaacagctgg
tctggagaagagcatgtgatgcacagagtgaatgataatggcatttggacgttatttatt
ccaggtataggagaaaaggaacgatataaatacgaaattgtgacgaataacggtgagatc
aggctgaaggcagatccatacgctatttattcagaagtcagaccaaacacagcgtcactt
acttacgatttggaaggatacagctggcaagatcaaaaatggcaaaagaaacagaaggct
aagacgctgtatgaaaaacctgttttcatttatgaactgcatcttgggtcttggaagaag
cattctgatggcaggcattattcctataaagaattaagtcagacgcttatcccttatatc
aagaagcatgggtttacccatattgaactgcttcccgtgtatgagcatccatatgatcgt
tcatgggggtaccaaggaacggggtattacagcccgacaagcaggtttggcccgccgcat
gatctgatgaagtttgtggatgaatgtcatcaacaaaatatcggagtcattttggattgg
gtccccggacatttttgtaaagatgcacatggcctttatatgtttgatggagaaccgctt
tatgaatacaaagaagaacgtgatcgggagaactggttatggggcacggcaaactttgac
ctggggaaaccggaagttcatagttttttaatttcgaatgcgttgtactgggcggaattc
tatcatatagatggatttagggttgatgcagtggctaatatcttgtattggccaaatcag
gatgaacgccacacgaatccatatgctgttgattttttaaaaaaactcaatcaaaccatg
agagaggcatatccccatgtgatgatgattgcagaagattctacagaatggcctcaagtg
acaggtgccgttgaggaaggggggcttggttttcattataaatggaatatgggatggatg
aatgacgtactgaaatacatggagacgccgcccgaagaaaggcggcattgtcatcagctt
atctctttttcattactatatgcgtttagtgaacattttgtattgccgttttctcatgat
gaagtcgtatacggaaaaaaatcacttctcaataaaatgcctggcgactactggcagaaa
tttgcccagtatcggcttttgctgggctatatgacagtgcatcccggaaagaaattgatc
tttatgggatcagagtttgctcaatttgatgaatggaaagatacagaacagcttgattgg
tttttggactccttccccatgcatcagaaagccagcgtttttacgcaagatcttctccgc
ttttaccaaaaaagcaaaatcctttatgagcatgaccatcgtgcacaatcgtttgaatgg
attgatgtccataatgacgaacaatcaatcttttcttttattcgttatggccaaaagcac
ggtgaggcgcttgtcatcatttgtaattttacacccgtggtctatcatcaatatgatgtt
ggagttcctttttttactcaatacattgaagtgcttaacagtgacagtgaaacatatgga
ggctcagggcaaatcaacaaaaagccgttatcggctaaaaagggagcacttcatcataaa
ccgtgttatatcacgatgaccatccccccttacggcatctcgattttacgggcggttaaa
aaaagaggagagataaaaagatga

DBGET integrated database retrieval system