KEGG   Bacillus subtilis subsp. subtilis 168: BSU31080Help
Entry
BSU31080          CDS       T00010                                 

Gene name
yuaB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
3187503..3188048
Genome map
AA seq 181 aa AA seqDB search
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKT
EWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLA
LDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGC
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaattattatcttctttggcaattagtgcattaagtctcgggttactcgtt
tctgcacctacagcttctttcgcggctgaatctacatcaactaaagctcatactgaatcc
actatgagaacacagtctacagcttcattgttcgcaacaatcactggcgccagcaaaacg
gaatggtctttctcagatatcgaattgacttaccgtccaaacacgcttctcagccttggc
gttatggagtttacattgccaagcggatttactgcaaacacgaaagacacattgaacgga
aatgccttgcgtacaacacagatcctcaataacgggaaaacagtaagagttcctttggca
cttgatttgttaggagctggcgaattcaaattaaaactgaataacaaaacacttcctgcc
gctggtacatatactttccgtgcggagaataaatcattaagcatcggaaataaattttac
gcagaagccagcattgacgtggctaagcgcagcactcctccgactcagccttgcggttgc
aactaa

DBGET integrated database retrieval system