KEGG   Bacillus subtilis subsp. subtilis 168: BSU31600Help
Entry
BSU31600          CDS       T00010                                 

Gene name
mrpA
Definition
(RefSeq) Na(+)/H(+) antiporter subunit A
  KO
K05565  
multicomponent Na+:H+ antiporter subunit A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU31600 (mrpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
3246598..3249003
Genome map
AA seq 801 aa AA seqDB search
MQLLHLAILSPFLFAFIIPFLAKYAKRVHTGWFVLILPVLLFIYFLPMIRMTQSGETLRS
VLEWIPSLGINFTVYIDGLGLLFALLITGIGSLVTLYSIFYLSKEKEQLGPFYVYLLMFM
GAMLGVVLVDNVMVLYMFWELTSLSSFLLIGYWYKREKSRYGAAKSLLITVSGGLCMLGG
FILLYLITDSFSIREMVHQVQLIAGHELFIPAMILILLGAFTKSAQFPFYIWLPDAMEAP
TPVSAYLHSATMVKAGIYVIARFSPIFAFSAQWFWIVSLVGLFTMVWGSFHAVKQTDLKS
ILAFSTVSQLGMIISMLGVSAAALHYGHTEYYTVAAMAAIFHLINHATFKGSLFMAVGII
DHETGTRDIRKLGGLMAIMPITFTISLIGTFSMAGLPPFNGFLSKEMFFTSMLRVTHFDL
FNVQTWGVLFPLFAWIGSVFTFIYSMKLLFKTFRGNYQPEQLEKQAHEAPVGMLVPPVIL
VALAVSLFFFPNILSYSLIEPAMNSIYPTLLDGHEKFHVHISQWHGVTTELLMTAGIVVI
GTIGYLSLNKWKGIYKLFPSKLTLNRLYDKLLTMMEKGSYRVTKQYMTGFLRDYLLYIFA
GFIILIGGAFAIKGGFSFKTEGMAKIGVYEIILTLVMISATVATVFARSRLTAIIALGVV
GYTLALFFVIFRAPDLALTQLVIETISVALFLLCFYHLPKLRLKTKTRTFRMTNFIISLG
VGVIVTLLGIASSSQRTKDSIASFFVKHSHDLGGGDNVVNVILVDFRGFDTMFEITVLTI
AALGIYSMIKTKVKEEGKSGE
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
ttgcagctcttacatcttgctattttatcgccttttttatttgcttttatcattcccttc
ttggcaaaatacgcaaaaagagtgcatacgggctggtttgtgttgatcctgcccgtcttg
ctgtttatatactttctcccaatgatcaggatgacgcaatctggagaaacacttcgatcg
gtattagagtggattccgtcactcggcattaactttaccgtttatatagacggcctcggg
ttattattcgctttactgatcacaggcattggctctttggtcactctttacagcattttt
tatttatcgaaagaaaaagaacagcttgggcccttttatgtctacttattgatgttcatg
ggcgccatgctcggcgtcgttctagtagacaatgtcatggttctctacatgttctgggag
cttacaagcctttcatcctttttgctgatcggctattggtataagcgggaaaagtcgcgc
tatggcgcagccaaatcacttttgattacggtcagcggcgggctgtgcatgctcggcgga
tttattctcctttatttgataacggattccttcagtattcgagagatggttcaccaggtt
caattaattgccggccacgaattgtttatcccggctatgattctcattttattaggggct
tttacgaaatcggcgcaatttcctttttacatctggctccctgacgcgatggaagctccg
acgcctgtcagcgcttatctccattcagctactatggtaaaagccggcatttatgtgatt
gcgagattcagtcctattttcgccttttcagctcagtggttttggatcgtgtccctcgtc
ggcctctttacgatggtttggggttcattccatgccgtgaaacaaactgatttaaaatcg
attttggcgttttcaaccgtcagccagctcggcatgatcatctccatgctcggagtcagt
gctgcggcccttcattacggacatacagaatattatacagttgccgctatggctgccatt
ttccatttgatcaaccacgcaacctttaaaggaagcttgtttatggcagtcgggattatc
gatcacgaaacaggcacacgggatatccggaagctaggcggcctgatggcgattatgccg
attacttttaccatttccttaatcgggacattttcaatggccggcctaccgccgtttaac
ggatttttgagtaaagaaatgtttttcacaagcatgcttcgcgtgacacattttgacctg
ttcaacgtgcagacatggggcgttctgttccctcttttcgcctggatcggaagtgtattt
acgtttatctacagcatgaaattgctgtttaaaacattcagaggaaattaccagcctgaa
cagcttgaaaaacaggctcacgaagcgcctgtcggtatgctcgttccaccggtcattctt
gtcgctttggctgtcagtctcttctttttcccgaatatattgtcgtacagcctgatagag
cctgcgatgaactcaatctatccgacactgcttgacggccatgagaaattccacgttcac
atttcacagtggcatggggttacaacggaattgctcatgactgcgggtattgttgtgatc
ggaacaattggttatttgtcgctgaataagtggaaaggaatctataaactgtttccttcg
aaactcacactcaaccggttatacgataagcttttgactatgatggagaaaggctcttac
cgggtcacaaaacaatatatgaccgggtttttaagagattatttgctgtatatcttcgct
ggtttcatcattctgataggcggagcttttgccattaaaggcggattttcatttaaaacg
gaaggcatggctaaaatcggtgtatacgaaatcattttgacgcttgtcatgatcagcgcc
acagtggcgactgtttttgctaggtcaagactgacggcgatcattgcactcggtgttgtc
ggttatacgcttgcattgttttttgtcattttcagagcgccggacttggcattgactcag
ctcgtcattgaaacgatttctgtggcactgtttctgctttgcttctaccatttgccgaaa
ctgaggctgaaaacaaaaacgagaacgttccggatgacgaattttatcatttctttaggc
gtcggtgttatcgttacactgctcggcatcgcatcctcaagccagcggacaaaagacagc
attgcgtccttctttgtcaaacacagccacgatctcggcggaggggataatgtcgtcaat
gtcattctcgttgatttcaggggatttgatacaatgtttgaaattacggtattaacgata
gccgctctcggcatttacagcatgattaaaacaaaagtaaaagaggaggggaaaagcggt
gaatga

DBGET integrated database retrieval system