KEGG   Bacillus subtilis subsp. subtilis 168: BSU31740Help
Entry
BSU31740          CDS       T00010                                 

Gene name
pdeH
Definition
(RefSeq) phosphodiesterase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3258037..3259266)
Genome map
AA seq 409 aa AA seqDB search
MRVFVARQPIFNRKEQVVAYELLYRESEENVYSAKDGDQATTDLVINSFLNIGIEKLTEG
KRCFVNFTESLMFSNLPTSFNPKQLVIEILEDIPITPALISRCKELKKMGYMLALDDFYA
INPQDEDLLEKLMSYIDILKIDFLKTTRMERRTILQTYGCRGLIFLAEKVETRKEYKQAV
QDGFQLFQGYFFSEPRIISGHDLSTHFYSYYELLNELSKEQPNIKRVTEYIERDLSLSYQ
ILKFLNSSHSRLSQKIESIQQAIMLLGFNEIKRWIYILSFKDLSRKGHSSKHEIIKISLI
RAKLCELLARKTSRPQPASYMLIGMFSLIDTLLHREIEEIVQELPLKDEVGQALLGHQND
YYQMLELVKLIESNNWDTCSELGNQLDKEEAYECYLEALEWCHNLMDAK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgtttgttgcaagacagcctatttttaatagaaaagaacaggttgttgcttat
gaactgctgtatagagaaagcgaagagaacgtgtatagcgctaaagacggcgatcaggca
acaacagatttggtgatcaacagctttttaaacatcggaattgagaagctgacggaaggg
aaacgctgttttgttaattttacggaaagcctgatgttttcgaatcttcccacctccttc
aatccgaaacagcttgtcattgaaatccttgaagatataccgatcacgccggccctcatt
tctagatgcaaagaattgaaaaaaatggggtatatgctggcgcttgatgatttttatgca
ataaatccgcaagatgaggacttactggaaaaactcatgagctatattgatatattgaaa
attgattttctcaaaacaacacgaatggaacgcagaacaattttgcaaacctacggctgc
cgcggcctgatttttttagcggaaaaagtagagacccgaaaagaatataaacaggcggtc
caagacggctttcaattattccaaggctactttttcagcgagccgcgcatcatcagcggg
catgacctatcgactcatttctattcttactatgaactgcttaacgaactgagtaaagag
cagcctaacataaagcgtgtgacagagtacatagagcgggatttatcactgtcctatcaa
attttaaaatttttaaactcatcccacagccgtttgagccagaaaattgaaagcattcaa
caggccattatgctgctgggatttaatgaaatcaaacggtggatatatattctttccttt
aaggatttaagcaggaaagggcattccagcaagcacgaaatcattaagatttctctgata
agagcaaagctttgcgaactgctggcgagaaagacatcccggccgcagcctgcttcttat
atgctgatcggaatgttttctctcatagacaccctcctgcatagagaaatagaggaaatt
gttcaagaattgcctttaaaagatgaagtcgggcaagcattattaggccatcaaaacgac
tactaccaaatgcttgagcttgtgaaattaattgaaagcaacaactgggacacttgctca
gaattaggcaatcaactggacaaagaagaagcgtatgaatgttatttagaggctctggaa
tggtgtcataatcttatggacgcaaaatga

DBGET integrated database retrieval system