KEGG   Bacillus subtilis subsp. subtilis 168: BSU32250Help
Entry
BSU32250          CDS       T00010                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSU32250 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU32250 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSU32250 (thrC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BSU32250 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3313770..3314828)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVM
YGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRI
GNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttttacctgtaacagatcaaacaccg
gcgctaactttacatgaaggaaacacacctcttattcacctgccgaagctgtctgagcag
ctcggaattgagcttcatgtcaaaacggaaggcgtcaatcctacgggatcatttaaagat
cgcggaatggttatggctgtggcaaaggcaaaagaagaaggcaatgacacgattatgtgc
gcgtcaacaggtaacacttccgctgctgcggcagcatatgcagcccgtgctaacatgaaa
tgcattgtcatcatcccgaacggaaaaattgcatttggaaaactcgctcaagctgtcatg
tacggagccgagattatcgcaattgacggaaactttgacgatgcgcttaaaattgtccgt
tccatctgtgagaaatcaccgattgcccttgtcaactcagtcaacccttaccgcattgaa
ggccaaaaaactgctgccttcgaagtgtgcgaacagctgggggaagcgcctgatgtttta
gcgatcccggtcggaaatgctggaaacatcactgcgtactggaagggcttcaaggaatat
catgagaaaaacggcacaggccttccgaaaatgcgcggctttgaagctgagggtgcggcg
gcaatcgtgcgcaatgaagtgattgaaaatccggaaacaatagcgacagccattcgtatc
ggaaacccggcaagctgggacaaagctgtaaaggcagccgaggaatccaatgggaaaatt
gacgaagtcactgatgatgaaatccttcacgcatatcagctgatcgcccgtgtagaaggc
gtgtttgcagaaccaggttcttgcgcgtctatcgcaggagtgctgaaacaggtgaaatcc
ggagaaattccgaaaggcagcaaggtcgtagctgtgttaacaggaaacggactgaaagat
ccgaacacagcggtcgacatttcagaaatcaagcctgtcacattgccgactgatgaagac
agcatccttgaatatgtaaaaggagcggcccgtgtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system