KEGG   Bacillus subtilis subsp. subtilis 168: BSU32450Help
Entry
BSU32450          CDS       T00010                                 

Gene name
pucL
Definition
(RefSeq) urate oxidase with peroxide reductase N-terminal domain
  KO
K16838  urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.97]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BSU32450 (pucL)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BSU32450 (pucL)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     BSU32450 (pucL)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     BSU32450 (pucL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OHCU_decarbox Uricase Polyoma_coat2
Motif
Other DBs
NCBI-GeneID: 936669
NCBI-ProteinID: NP_391125
Pasteur: BG13986
BSORF: BG13986
UniProt: O32141
Position
3333162..3334646
Genome map
AA seq 494 aa AA seqDB search
MFTMDDLNQMDTQTLTDTLGSIFEHSSWIAERSAALRPFSSLSDLHRKMTGIVKAADRET
QLDLIKKHPRLGTKKTMSDDSVREQQNAGLGKLEQQEYEEFLMLNEHYYDRFGFPFILAV
KGKTKQDIHQALLARLESERETEFQQALIEIYRIARFRLADIITEKGETQMKRTMSYGKG
NVFAYRTYLKPLTGVKQIPESSFAGRDNTVVGVDVTCEIGGEAFLPSFTDGDNTLVVATD
SMKNFIQRHLASYEGTTTEGFLHYVAHRFLDTYSHMDTITLTGEDIPFEAMPAYEEKELS
TSRLVFRRSRNERSRSVLKAERSGNTITITEQYSEIMDLQLVKVSGNSFVGFIRDEYTTL
PEDGNRPLFVYLNISWQYENTNDSYASDPARYVAAEQVRDLASTVFHELETPSIQNLIYH
IGCRILARFPQLTDVSFQSQNHTWDTVVEEIPGSKGKVYTEPRPPYGFQHFTVTREDAEK
EKQKAAEKCRSLKA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaatggatgacctgaaccaaatggacacacaaacactgacagacacacttggc
tctatttttgaacactcttcatggattgcggagagatccgcagcactacggccgttttcg
tccctttctgatcttcaccgcaaaatgactggcattgtaaaagctgcggatcgcgagaca
cagcttgatttaatcaaaaagcatccccggctcggaacaaagaaaacaatgagcgatgac
tcggtacgagagcagcagaacgcagggctcggcaaattagaacagcaggaatacgaggag
tttctcatgctgaatgaacactattatgatcgcttcggctttccttttattttagcggtg
aagggaaagacgaaacaggacattcaccaagccctgctggcaaggcttgagagcgaacga
gaaacggagttccagcaggcccttatagaaatttaccgaatcgcccgctttcgtctggct
gacatcatcactgaaaaaggagagacgcaaatgaaaagaaccatgtcttatggcaaagga
aatgtatttgcataccgaacgtatttaaaaccgctcactggagtgaagcaaatcccggaa
tcatcttttgccggaagagataataccgttgtcggcgttgatgtgacatgcgaaattggc
ggagaagccttcctgccatcatttacagacggagacaacactctcgtcgtggcaacggat
tcaatgaaaaactttatccagcgccatctcgcatcctatgaaggaacgacaaccgagggg
ttcctacactatgtagctcaccgatttttagatacctattctcatatggacacgatcact
ctgactggcgaagacattccgtttgaagcaatgcctgcatacgaggagaaagagctcagc
acaagccgcctcgtcttcagaagatcgcgtaatgaacgaagccgctctgtgctgaaagca
gaacgaagcgggaataccataacgattacagagcaatacagcgaaatcatggatcttcag
ctcgtcaaggtgagcggcaactccttcgtcggcttcatccgggacgaatatacgactctc
ccggaagacggcaaccgcccgctgtttgtctatttaaacatcagctggcaatatgaaaat
acaaatgactcatacgcttctgatccagcacgctacgttgcggctgaacaagtccgcgac
ttagcgagcaccgtttttcacgagctcgaaaccccttcaatccaaaacctaatctatcat
atcggctgcagaatattagcgaggttcccgcagctcactgatgtcagcttccaatctcaa
aatcacacgtgggatacggttgtcgaagaaatcccgggctcaaaaggaaaagtctacacc
gaaccgcgcccgccatacggtttccaacattttaccgtgacaagagaagacgccgagaaa
gaaaaacagaaagccgctgaaaaatgtcggagcctgaaagcctga

DBGET integrated database retrieval system