KEGG   Bacillus subtilis subsp. subtilis 168: BSU33160Help
Entry
BSU33160          CDS       T00010                                 

Gene name
yvrA
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU33160 (yvrA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     BSU33160 (yvrA)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU33160 (yvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3401141..3402469)
Genome map
AA seq 442 aa AA seqDB search
MKAEGLSGGYGDSRLINNVSLTVEKGEFLGILGPNGSGKTTLLHLLTGTLPAKKGRVYLA
GKLLADYKPKELAQIMAVLPQKMDQAFTFTVEETVAFGRYPFQTGLFRQQTEKGEAIVQE
AMEQTGVADFAQKPIRELSGGEQQRVYLAQALAQQPRILFLDEPTNFLDLAYQKDLLDLI
KRLTRESGLAAVSVFHDLNTASLYCDGLMFMKNGTAGPKQKPEYAVTEQSIKAVYDTDVT
ALVHQSSPKPMIVIQPEKDSVKRQSIPFEALLQAGRDDILLQTEIPLRTLSSTPIGAGFS
WSRTLIHKRLPDQPDPIEGLTACLSESGFQLQETCAMASSERLDRFVYRTYEDGELSVFI
CVQTGFSIWILINGYAADQFFIKALMAAEAERTKVLGDGGGTGDILIAATQTQQSENIEQ
RLNQLIKKGTAECIKEAAELFE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagaagggctgtcgggaggatacggcgacagccgcctaatcaacaatgtcagc
ttaacagtggagaagggagaatttcttggaattctcggccctaatggaagcggaaaaacc
acgcttttgcacttgctgacaggtacgctgccggccaagaaaggcagggtttatctggcc
ggaaaactgctggcggactataaaccgaaggaactggcgcaaatcatggctgtcctgccg
caaaaaatggatcaagccttcacctttactgtcgaagaaactgtagcctttggcagatat
ccattccaaacggggctgttcagacagcagactgaaaagggtgaagccattgtacaggaa
gcaatggagcaaacaggagtggccgattttgcgcaaaagccgattcgcgaactaagcgga
ggggaacagcagcgggtgtatttggcacaagctttggcgcagcagccgcgtattttattt
ttggacgagccgactaattttctcgatctggcttatcaaaaagacctgcttgatctgatc
aaacgcctgacgagagaaagcggattggcagctgtcagcgtttttcatgatctgaacacc
gcaagcctgtactgtgatgggctcatgtttatgaaaaacggtaccgccgggcctaagcaa
aaaccggaatatgctgttacagaacaaagcataaaggcggtgtacgatacagatgtcacc
gccttggttcatcaaagctcacctaaaccgatgattgtgattcagcctgaaaaagatagc
gtgaagcggcagtctatcccatttgaagcattgctccaagcggggcgtgatgacattctt
ctgcaaacggaaatcccgcttcgaacattgtcctccacgcctatcggtgcagggttttcg
tggagcaggacgctgatccataaacggctgccagatcagccagatccgatagaaggactt
acggcctgtctttcagaaagcggttttcaactgcaggagacgtgtgcgatggcttcttca
gaaagacttgaccgtttcgtgtatcgaacatatgaagacggagagttatccgttttcata
tgcgttcagaccggcttttcgatttggattttgattaacggctatgcggcagatcaattc
ttcatcaaagctcttatggctgccgaagcagaacggacgaaagtgctgggagacggagga
ggcacaggtgatattctcatcgccgcgactcaaactcagcaatcagaaaacatagaacag
cggctgaaccaattgataaagaaagggacagctgaatgtataaaagaggctgctgagttg
tttgaataa

DBGET integrated database retrieval system