KEGG   Bacillus subtilis subsp. subtilis 168: BSU33900Help
Entry
BSU33900          CDS       T00010                                 

Gene name
eno
Definition
(RefSeq) enolase
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSU33900 (eno)
   01230 Biosynthesis of amino acids
    BSU33900 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU33900 (eno)
  Energy metabolism
   00680 Methane metabolism
    BSU33900 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BSU33900 (eno)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BSU33900 (eno)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BSU33900 (eno)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU33900 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3476555..3477847)
Genome map
AA seq 430 aa AA seqDB search
MPYIVDVYAREVLDSRGNPTVEVEVYTETGAFGRALVPSGASTGEYEAVELRDGDKDRYL
GKGVLTAVNNVNEIIAPELLGFDVTEQNAIDQLLIELDGTENKGKLGANAILGVSMACAR
AAADFLQIPLYQYLGGFNSKTLPVPMMNIVNGGEHADNNVDIQEFMIMPVGAPNFREALR
MGAQIFHSLKSVLSAKGLNTAVGDEGGFAPNLGSNEEALQTIVEAIEKAGFKPGEEVKLA
MDAASSEFYNKEDGKYHLSGEGVVKTSAEMVDWYEELVSKYPIISIEDGLDENDWEGHKL
LTERLGKKVQLVGDDLFVTNTKKLSEGIKNGVGNSILIKVNQIGTLTETFDAIEMAKRAG
YTAVISHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLAETAQYH
GINSFYNLNK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccatacattgttgatgtttatgcacgcgaagtattagactcccgcggcaacccaaca
gttgaagttgaagtatatacagaaacaggagctttcggccgcgcattagtgccaagcgga
gcttctacaggtgaatacgaagcggttgagcttcgtgacggcgacaaagaccgttacctt
ggaaaaggcgtgttaacagctgttaacaacgtaaacgaaatcattgctccagagcttctt
ggctttgatgtaactgaacaaaacgcaatcgatcagcttttaatcgagcttgacggtact
gaaaacaaaggcaaacttggtgcgaacgcaatccttggcgtatctatggcttgtgcgcgt
gctgctgctgatttcttacagattcctctttaccaataccttggaggattcaactcaaaa
acgcttcctgtaccgatgatgaacatcgtaaacggcggagagcatgctgataacaacgtg
gatattcaagaattcatgatcatgcctgtaggtgctcctaacttccgtgaagcacttcgc
atgggcgctcaaatcttccacagcctgaaatcagtattaagcgcaaaaggcttaaacact
gctgtaggtgacgaaggcggattcgctccaaaccttggttctaacgaagaagcgcttcaa
acaatcgttgaagcaatcgaaaaagccggcttcaaacctggcgaagaagttaaacttgct
atggatgctgcatcttctgagttctacaacaaagaagacggcaaataccatctgtctggc
gaaggcgttgtgaaaacatctgctgaaatggttgactggtatgaagagcttgtttctaaa
tacccaatcatctcgatcgaagacggacttgacgaaaacgactgggaaggccacaagctt
cttactgagcgtcttggcaaaaaagttcagcttgttggtgacgacctcttcgttacaaac
acgaaaaaactttctgaaggtattaaaaacggcgtaggcaactctatcctgatcaaagta
aaccaaatcggtacattgactgaaacattcgatgcgatcgaaatggcgaaacgcgcaggc
tacacagctgttatctctcaccgttctggtgaaactgaagacagcacaatcgctgacatc
gctgtggcaacaaacgcaggacaaatcaaaacaggtgctccgtctcgtacggaccgtgtt
gcgaaatacaaccagcttcttcgcatcgaagatcagttggctgaaactgctcaataccac
ggtatcaactctttctacaacttaaacaagtaa

DBGET integrated database retrieval system