KEGG   Bacillus subtilis subsp. subtilis 168: BSU34130Help
Entry
BSU34130          CDS       T00010                                 

Gene name
ganA
Definition
arabinogalactan type I oligomer exo-hydrolase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSU34130 (ganA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BSU34130 (ganA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3503020..3505083)
Genome map
AA seq 687 aa AA seqDB search
MMSKLEKTHVTKAKFMLHGGDYNPDQWLDRPDILADDIKLMKLSHTNTFSVGIFAWSALE
PEEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEVLRVNASRVKQLHGGR
HNHCLTSKVYREKTRHINRLLAERYGHHPALLMWHISNEYGGDCHCDLCQHAFREWLKSK
YDNSLKTLNHAWWTPFWSHTFNDWSQIESPSPIGENGLHGLNLDWRRFVTDQTISFYENE
IIPLKELTPDIPITTNFMADTPDLIPYQGLDYSKFAKHVDAISWDAYPVWHNDWESTADL
AMKVGFINDLYRSLKQQPFLLMECTPSAVNWHNVNKAKRPGMNLLSSMQMIAHGSDSVLY
FQYRKSRGSSEKLHGAVVDHDNSPKNRVFQEVAKVGETLERLSEVVGTKRPAQTAILYDW
ENHWALEDAQGFAKATKRYPQTLQQHYRTFWEHDIPVDVITKEQDFSPYKLLIVPMLYLI
SEDTVSRLKAFTADGGTLVMTYISGVVNEHDLTYTGGWHPDLQAIFGVEPLETDTLYPKD
RNAVSYRSQIYEMKDYATVIDVKTASVEAVYQEDFYARTPAVTSHEYQQGKAYFIGARLE
DQFQRDFYEGLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTFDQSV
KDIMTGDILSGDLTMEKYEVRIVVNTH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcaaagcttgaaaaaacgcacgtaacaaaagcaaaatttatgctccatggggga
gactacaaccccgatcagtggctggatcggcccgatattttagctgacgatatcaaactg
atgaagctttctcatacgaatacgttttctgtcggcatttttgcatggagcgcacttgag
ccggaggagggcgtatatcaatttgaatggctggatgatatttttgagcggattcacagt
ataggcggccgggtcatattagcaacgccgagcggagcccgtccggcctggctgtcgcaa
acctatccggaagttttgcgcgtcaatgcctcccgcgtcaaacagctgcacggcggaagg
cacaaccactgcctcacatctaaagtctaccgagaaaaaacacggcacatcaaccgctta
ttagcagaacgatacggacatcacccggcgctgttaatgtggcacatttcaaacgaatac
gggggagattgccactgtgatttatgccagcatgctttccgggagtggctgaaatcgaaa
tatgacaacagcctcaagacattgaaccatgcgtggtggacccctttttggagccatacg
ttcaatgactggtcacaaattgaaagcccttcgccgatcggtgaaaatggcttgcatggc
ctgaatttagattggcgccggttcgtcaccgatcaaacgatttcgttttatgaaaatgaa
atcattccgctgaaagaattgacgcctgatatccctatcacaacgaattttatggctgac
acaccggatttgatcccgtatcagggcctcgactacagcaaatttgcaaagcatgtcgat
gccatcagctgggacgcttatcctgtctggcacaatgactgggaaagcacagctgatttg
gcgatgaaggtcggctttatcaatgatctgtaccgaagcttgaagcagcagcccttctta
ttaatggagtgtacgccaagcgcggtcaattggcataacgtcaacaaggcaaagcgcccg
ggcatgaatctgctgtcatccatgcaaatgattgcccacggctcggacagcgttctctat
ttccaataccgcaaatcacgggggtcatcagaaaaattacacggagcggttgtggatcat
gacaatagcccgaagaaccgcgtctttcaagaagtggccaaggtaggcgagacattggaa
cggctgtccgaagttgtcggaacgaagaggccggctcaaaccgcgattttatatgactgg
gaaaatcattgggcgctcgaggatgctcaggggtttgcgaaggcgacaaaacgttatccg
caaacgcttcagcagcattaccgcacattctgggaacacgatatccctgtcgacgtcatc
acgaaagaacaagacttttcaccatataaactgctgatcgtcccgatgctgtatttaatc
agcgaggacaccgtttcccgtttaaaagcgtttacggctgacggcggcaccttagtcatg
acgtatatcagcggggttgtgaatgagcatgacttaacatacacaggcggatggcatccg
gatcttcaagctatatttggagttgagcctcttgaaacggacaccctgtatccgaaggat
cgaaacgctgtcagctaccgcagccaaatatatgaaatgaaggattatgcaaccgtgatt
gatgtaaagacagcttcagtggaagcggtgtatcaagaagatttttatgcgcgcacgcca
gcggtcacaagccatgagtatcagcagggcaaggcgtattttatcggcgcgcgtttggag
gatcaatttcagcgtgatttctatgagggtctgatcacagacctgtctctctctccagtt
tttccggttcggcacggaaaaggcgtctccgtacaagcgaggcaggatcaggacaatgat
tatatttttgtcatgaatttcacggaagaaaaacagctggtcacgtttgatcagagtgtg
aaggacataatgacaggagacatattgtcaggcgacctgacgatggaaaagtatgaagtg
agaattgtcgtaaacacacattag

DBGET integrated database retrieval system