KEGG   Bacillus subtilis subsp. subtilis 168: BSU35770Help
Entry
BSU35770          CDS       T00010                                 

Gene name
tagC
Definition
(RefSeq) major teichoic acid biosynthesis protein C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
3683438..3684766
Genome map
AA seq 442 aa AA seqDB search
MRKKELFDFTNITPKLFTELRVADKTVLQSFNFDEKNHQIYTTQVASGLGKDNTQSYRIT
RLSLEGLQLDSMLLKHGGHGTNIGIENRNGTIYIWSLYDKPNETDKSELVCFPYKAGATL
DENSKELQRFSNMPFDHRVTPALDMKNRQLAIRQYDTKNNNNKQWVTIFNLDDAIANKNN
PLYTINIPDELHYLQGFFLDDGYLYWYTGDTNSKSYPNLITVFDSDNKIVLQKEITVGKD
LSTRYENNFREPEGICMYTNPETGAKSLMVGITSGKEGNRISRIYAYHSYENFMNHVPML
RSPLLKTVGHQDTPPERFQPFIQTFILEYNAQNKKWMVPTSGYLPSYTSNLVRNITINAD
GNLQVTLNERYISLLHQSIEGDFRLKQKDIRMGSWYFAGGEKSNVLEIGFMKGSTKIRPD
DAAISNASRMSIFMIVADKIEV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagaactgtttgatttcaccaacatcacgccaaaattatttactgaacta
cgtgtagcagacaaaaccgtacttcaatcattcaatttcgatgagaaaaaccaccaaatt
tatacaacccaagtcgcaagtggattaggaaaagacaacacccaaagctatcgcataact
cgtctatctcttgaaggtttacaattagacagcatgctgttgaaacatggaggtcatggt
acaaatattggaattgaaaaccgtaatggcaccatttatatttggtctctatacgataaa
ccaaacgaaacagataaaagtgaattagtttgtttcccatataaagcaggcgcgacttta
gatgaaaattctaaagaacttcagcgattctcgaatatgcctttcgatcatagggttaca
cctgctcttgatatgaagaatagacagttggcaattagacaatacgatacaaaaaataat
aataataaacagtgggtgacaatctttaacctggacgatgcaatagcaaataaaaacaat
cctctttatactattaacattcctgacgaacttcattatttacaaggtttctttttagat
gacggttatttatattggtatacaggagatacaaacagcaaaagctatccgaatctcata
actgtatttgattccgataataaaatagtgctgcaaaaagaaattactgttggcaaagac
ttgtccaccagatatgagaataacttccgtgaaccggaagggatctgtatgtacaccaat
cctgaaactggggcaaaatcattaatggtgggaattacaagtggaaaagaaggaaatcgt
ataagcagaatttatgcataccattcttatgaaaacttcatgaatcatgtacctatgctt
cgatcccctttattaaaaaccgtggggcaccaagatacacctccagaaagatttcaacca
tttattcaaaccttcattttagagtataatgctcaaaacaaaaaatggatggttccgact
tcaggttatttaccatcttacacatcaaatttagtccgaaatattactatcaatgcagat
ggaaacttgcaagtcacattaaatgaacgctatattagtttactgcatcaatcgatagaa
ggagatttccgcttaaaacaaaaggatatccgaatgggatcctggtattttgccggcgga
gaaaaatcaaatgtgcttgaaataggttttatgaaagggagtacaaaaatcagacccgat
gatgcagccatctcaaatgcttcaagaatgagtatttttatgattgttgcggacaagatt
gaggtgtga

DBGET integrated database retrieval system