KEGG   Bacillus subtilis subsp. subtilis 168: BSU35800Help
Entry
BSU35800          CDS       T00010                                 

Gene name
gerBA
Definition
(RefSeq) spore germination protein B1
  KO
K06291  
spore germination protein BA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
3688812..3690263
Genome map
AA seq 483 aa AA seqDB search
MQIDSDLQNNLDTLKKTLGQNDDMMFYTFAFGDSRQKACLLYIDGLTENKMLAQYVISPL
QKEALAHKECSIEDLSAFFFGFHHSVVSTMKEIEQLVFSGQAILLADGYRGGLAFDTKSV
ATRSLDEPSSEVVERGPKIGFIEKLRTNTALLRERTSDPNLVIKEMTLGKRTKKKIAVAY
IQDIAPDYVVKEVFKRLKSVNIDNLPESGTLEQLIEDEPFSIFPTILSTERPDRVESSLL
EGRVSILVDGTPFALIVPATVDEFIHSPDDYSQRWIPMSLVRLLRYSSILITIYLPGLYI
SLVSFHTGLLPTRMAISIAGSRLNVPFPPFVEAFIMIFTIELIREAGLRLPKPIGQTIGL
IGGVVIGQAAVQAQIVSALMVIVVSVTALASFTVPSYAYNFPLRIIRIGVMISATALGMY
GVIMVYLFVIGHLMRLKSFGQDYIIPIMAQPGQDLKDTVIRIPTMFLKRRPTRNDPEDNI
RQR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgactctgatctccagaacaatttagacacactgaaaaaaacattgggacaa
aacgacgatatgatgttttatacatttgctttcggagatagcagacaaaaggcgtgttta
ctgtatattgacggtctgacagagaataaaatgctggcgcaatacgtcatttctccttta
caaaaagaggcgttggcccataaggaatgctcgattgaagacttatccgccttttttttc
ggctttcaccacagcgttgtttctacaatgaaagaaatagagcagctcgttttttcaggg
caagccattttgctcgctgatggctatcgcggaggattagctttcgacacaaagtcagtc
gcaacacgcagtcttgatgaaccctcctccgaagtcgtggaacgcggccctaaaatagga
tttattgaaaagctgcggacaaacacggcgcttttgcgtgaacggacgagtgatcctaat
ctcgtcatcaaagaaatgacactcggaaaaaggaccaaaaagaaaatcgctgtcgcttat
attcaggatatcgccccagattatgtcgtcaaagaagtgtttaaaaggctgaaatcagtc
aatatagataatttgccggaatcggggacgcttgaacagctgattgaagacgaaccattt
tcaattttccccacaatattaagcacagaacgaccggaccgggtcgaaagttctctatta
gaagggcgagtgtccatattagtggatggtacgccgtttgctttgattgtaccggctacg
gttgacgaatttattcattcgcccgatgattacagccagcgctggatcccaatgtcactt
gtacgccttcttcgttattccagcatcctgatcaccatttatttgcccggtctgtatatt
tctctcgtttcttttcacaccgggctattgccgactagaatggccatttccattgcaggc
agcaggcttaacgtaccattcccgccttttgtagaggcctttatcatgatctttacgatc
gaattgattcgagaagccggattaaggctgcctaagccgattggacagacaattggcctt
atcggcggcgttgtcatcggacaggcagctgttcaggcgcaaattgtcagtgcgcttatg
gtcattgtcgtttctgtcacagcactggcatcctttaccgttccttcatacgcctataac
tttccgctgcggatcattcggatcggggttatgataagtgcaacagcgcttggcatgtac
ggcgttataatggtttatctgtttgtgatcggccatctcatgcgcctgaaaagctttggc
caggattacattatcccgatcatggcgcagcctggacaggatttgaaagacacagtcatc
cgtattcccacgatgtttttaaaaagaagaccgacacgaaacgatcccgaagataacatc
agacaaaggtga

DBGET integrated database retrieval system