KEGG   Bacillus subtilis subsp. subtilis 168: BSU36760Help
Entry
BSU36760          CDS       T00010                                 

Gene name
murAA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bsu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3777949..3779259)
Genome map
AA seq 436 aa AA seqDB search
MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICDVPTLSDVYTINEVLRH
LGADVHFENNEVTVNASYALQTEAPFEYVRKMRASVLVMGPLLARTGHARVALPGGCAIG
SRPIDQHLKGFEAMGAEIKVGNGFIEAEVKGRLQGAKIYLDFPSVGATENLIMAAALAEG
TTTLENVAKEPEIVDLANYINGMGGKIRGAGTGTIKIEGVEKLHGVKHHIIPDRIEAGTF
MVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVTIKDEGEGLRVIGPKELKPIDIKTMPH
PGFPTDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIINGPVQ
LQGAEVAATDLRAGAALILAGLVAEGHTRVTELKHLDRGYVDFHQKLAALGADIERVNDE
SASEQENKEVVSDLNA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggcggtcagaagttaaacggcacagtcaaagttgaaggc
gctaaaaatgccgttttacctgttatcgctgcatctttattagcaagtgaagaaaaaagc
gtaatttgtgatgtacctacgctctccgatgtatatacaattaacgaagtgttgcgtcat
ttaggagcagatgtgcattttgaaaataatgaagtgactgtaaatgcttcatacgctttg
caaactgaagcaccttttgaatatgttcgtaaaatgcgtgcgtctgtgcttgtcatgggg
ccgcttcttgcgcgtacaggtcatgcaagagttgcacttccgggcggatgcgcaattggt
tccagaccgattgatcagcatttaaaaggttttgaagcaatgggcgcagaaatcaaagtc
ggtaatggcttcattgaagctgaagtaaaaggccgactgcaaggcgcaaaaatttatctg
gacttcccaagtgtaggagctacagagaacctgattatggcagccgctctagctgaagga
acaacaacgctggaaaacgtggcaaaagaacccgaaatcgttgatttagcaaactatatc
aacggcatgggcggaaaaatccgcggagctggcaccggcaccatcaaaattgaaggagtc
gaaaagcttcacggcgtaaaacaccatattattcctgaccgtattgaagcgggcacattt
atggttgctgctgcaatcactgaaggaaacgtattagtaaaaggagcggttcctgagcac
ctcacctctttaattgcaaaaatggaagagatgggtgtaacaattaaggatgaaggtgaa
ggtctgcgtgtcatcggcccgaaagagcttaaaccgattgacatcaaaacaatgcctcac
ccgggcttcccgactgatatgcagtcacaaatgatggcgcttctgcttcgtgcaagcggc
acaagcatgattacagaaaccgtttttgaaaaccgttttatgcatgcggaagaattccgc
cgtatgaatggtgatatcaagattgaaggacgttctgtcatcattaacggtcctgtacag
cttcagggagctgaagttgcagcgactgatttgcgtgcaggtgcagcgctgattcttgcg
gggttagtggctgaaggtcacacacgtgttactgaattgaagcacttagaccgcggttac
gttgatttccatcagaagcttgccgctctgggcgcagacatcgaacgtgtaaatgatgag
tctgcttctgagcaagagaataaagaagtcgtttctgacttaaatgcataa

DBGET integrated database retrieval system