KEGG   Bacillus subtilis subsp. subtilis 168: BSU37110Help
Entry
BSU37110          CDS       T00010                                 

Gene name
ywjH
Definition
transaldolase (EC:2.2.1.2)
Orthology
K00616  
transaldolase [EC:2.2.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bsu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsu01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bsu00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3807754..3808392)
Genome map
AA seq 212 aa AA seqDB search
MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVI
SLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAA
RAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGA
HIGTMPLKVIHALTKHPLTDKGIEQFLADWNK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttattctttgttgatacagccaatatcgatgaaattagagaagcgaatgaattagga
attctcgccggtgtaacgacgaatcctagtttagtagcaaaggaagctaacgtatcattc
cacgaccgtcttcgcgagatcacagacgtcgtgaaagggtctgtaagcgcagaggttatt
tctttgaaagctgaggaaatgatcgaggaaggaaaagaactggcgaagatcgctccgaac
attacggtgaaaatcccaatgacgtctgacggtttaaaagcggtaagagcacttactgac
ttaggcatcaaaacaaacgttacattgatcttcaatgccaaccaggcgcttcttgctgcc
agagcgggggcaacatatgtatctccattcctgggacgtttagatgacatcggccacaac
gggcttgacctgatttcagaagttaaacagatttttgacattcacggccttgacacgcaa
atcattgcagcgtcaatccgccatccgcagcacgtgacagaagctgctcttagaggggct
catatcggcacaatgccgctgaaagtcattcatgcgctcactaaacacccgttaacagac
aaaggaatcgaacaattcctggcagactggaacaaataa

DBGET integrated database retrieval system