KEGG   Bacillus subtilis subsp. subtilis 168: BSU37290Help
Entry
BSU37290          CDS       T00010                                 

Gene name
arfM
Definition
(RefSeq) transcription regulator ArfM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding Fez1
Motif
Other DBs
NCBI-GeneID: 937058
NCBI-ProteinID: NP_391610
Pasteur: BG11345
BSORF: BG11345
UniProt: P46910
Position
complement(3830141..3830617)
Genome map
AA seq 158 aa AA seqDB search
MNQCDYLLFLKQLPMFNEVPLSIVETLLKNGTFIRGSCDQSPSFLHSQSVYIVLKGSVRF
MDTRLPEGSKTVALWEKGDVFPIDEKGGLYLSPFISVNATSDILILNIPYYIFKKMMSYH
PQLQMNFLAMLQQNVFCSYQLFLRYLHTSQDENAEPGS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtgtgactatttattatttctgaaacaacttcctatgtttaatgaagtgcct
ctatccattgtcgaaaccttgctgaaaaacggcacgtttatccgcggttcatgtgatcag
tctccatcttttcttcattctcaatctgtttatattgtattaaaaggcagtgtccgtttt
atggacacaaggctccctgaagggtcgaaaaccgttgcgctgtgggaaaaaggcgatgtg
tttccgattgatgaaaaaggcgggctttatttatcgccctttatctcagtcaatgccact
tcagacattctgattctcaacatcccatattacatatttaagaaaatgatgtcttatcat
ccgcagctgcaaatgaactttttggctatgcttcagcaaaatgttttttgttcctatcaa
ttatttttgcggtatctgcatacatcacaggatgaaaacgctgagcccggttcttaa

DBGET integrated database retrieval system