KEGG   Bacillus subtilis subsp. subtilis 168: BSU37810Help
Entry
BSU37810          CDS       T00010                                 

Gene name
spsL
Definition
(RefSeq) spore coat polysaccharide biosynthesis protein SpsL
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00523  Polyketide sugar unit biosynthesis
bsu01130  Biosynthesis of antibiotics
Module
bsu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSU37810 (spsL)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU37810 (spsL)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BSU37810 (spsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-GeneID: 2914201
NCBI-ProteinID: YP_054595
Pasteur: BG14195
BSORF: BG14195
UniProt: Q7WY56
Position
complement(3882979..3883434)
Genome map
AA seq 151 aa AA seqDB search
MIDGVKVKKLMKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTMSYNPDQPDEKRIPWDDETIGFNWNTEFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatggagtcaaggtgaaaaaattgatgaagcatagcgatgacagaggctttttt
gctgagctggtccgggacgatgagaatctccttgagcattttgggcaggcctcttggtcg
aaaagctatccgggtgtgattaaggcatttcattatcatgagaagcaggatgatctctgg
ttcttcccaaccggccacgctcaggttgtcctatacgatcttcgagaggattcaaagaca
aaaggagaaacggacgtctattatatgggcgaagacaacccgatgctgttattaatccca
aaaggggtggctcacggatatagagtgctgggagagacgccgctgacaattatctatttt
accaccatgtcgtataacccggatcagcctgatgaaaaaagaattccgtgggatgatgag
acgatcggttttaactggaacactgaattcagataa

DBGET integrated database retrieval system