KEGG   Bacillus subtilis subsp. subtilis 168: BSU38040Help
Entry
BSU38040          CDS       T00010                                 

Gene name
sacA
Definition
sucrose-6-phosphate hydrolase (EC:3.2.1.26)
Orthology
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3902210..3903649)
Genome map
AA seq 479 aa AA seqDB search
MTAHDQELRRRAYEEVEKKEPIANSDPHRQHFHIMPPVGLLNDPNGVIYWKGSYHVFFQW
QPFQTGHGAKFWGHYTTQDVVNWKREEIALAPSDWFDKNGCYSGSAVTKDDRLYLFYTGN
VRDQDGNRETYQCLAVSDDGLSFEKKGVVARLPEGYTAHFRDPKVWEHEGTWYMVIGAQT
ENLKGQAVLFASDNLTEWRFLGPITGAGFNGLDDFGYMWECPDLFSLQGSDVLIVSPQGL
EADGFRYQNVYQSGYFVGRLDYNKPELKHGEFTELDQGFDFYAPQTLEDDQGRRILFAWM
AVPDQDEGSHPTIDCHWIHCMTLPRQLTLSGQKLIQQPLPELKAMRRNEKKIHINMHGSS
GALPVEKPERTEILLEDIHTESGFSISIRGTATFSFHKDEGIVTLERKSFDGKRTEARHC
RIKDLHTVHMFLDASSVEIFINNGEEVLSARYFPFPGNHEVTASATGKSEMNVGIWTLM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacatgaccaggagcttcgtcgccgggcttatgaagaagtggagaaaaaagag
cccatcgctaacagcgatccgcaccgccagcattttcatatcatgccgccggttgggctg
ctgaatgacccgaatggcgtgatttattggaagggcagctatcatgtattctttcagtgg
cagccgtttcagacggggcacggcgcaaaattttgggggcattatacgacacaggatgtt
gtgaattggaagcgggaagagattgcgctggctccgagtgattggtttgataaaaacggc
tgctactcgggcagcgctgtcacgaaagacgatcggctctatcttttttacacaggaaat
gtcagggatcaggatggaaatcgggaaacgtatcaatgccttgctgtttctgacgacggg
ctgtcctttgagaaaaagggtgtcgtcgcccgccttccggaaggatatacggcgcatttt
cgcgatccgaaggtatgggagcatgaaggcacatggtatatggtgattggtgcgcaaaca
gagaatttgaaagggcaggctgtgttgtttgcttctgataacctgacagagtggagattt
cttggcccgataaccggcgcgggcttcaacgggctggacgattttggatacatgtgggaa
tgccctgatttgttttcccttcaaggatcggatgtgctgattgtttcgcctcaagggctt
gaggctgacggtttccgttatcagaacgtatatcaatcaggttattttgtcggccgcctc
gattataacaagcctgaactgaagcatggtgaatttacggagcttgatcaaggttttgat
ttttacgcgccgcaaacacttgaagacgatcagggaaggcggattttatttgcatggatg
gcggtgcctgatcaggatgaagggtcccatccgaccattgactgccactggattcactgc
atgacgctgccgagacagctgacgctttcaggacagaagctgattcagcagccgctgcct
gagctaaaagccatgcgcagaaatgagaaaaaaatacacatcaacatgcatggatcatct
ggtgcgcttccagtggaaaaacctgaaagaactgagattctactggaagacattcatacg
gagtctggcttttcaatcagtatccgcggaacggctacgttttccttccataaagacgag
gggattgttacgctggaacgaaagagctttgacggaaaaagaacagaagcgagacattgc
cgcatcaaggatttgcataccgtacacatgtttctcgacgcgtcatctgtggaaatcttt
atcaataacggagaagaggtcttgagtgcaagatattttcctttcccgggaaatcatgaa
gtaacagccagtgcgaccgggaaatctgaaatgaatgtcggaatttggacacttatgtag

DBGET integrated database retrieval system