KEGG   Bacillus subtilis subsp. subtilis 168: BSU38040Help
Entry
BSU38040          CDS       T00010                                 

Gene name
sacA
Definition
sucrose-6-phosphate hydrolase (EC:3.2.1.26)
Orthology
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSU38040 (sacA)
   00500 Starch and sucrose metabolism
    BSU38040 (sacA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BSU38040 (sacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3902210..3903649)
Genome map
AA seq 479 aa AA seqDB search
MTAHDQELRRRAYEEVEKKEPIANSDPHRQHFHIMPPVGLLNDPNGVIYWKGSYHVFFQW
QPFQTGHGAKFWGHYTTQDVVNWKREEIALAPSDWFDKNGCYSGSAVTKDDRLYLFYTGN
VRDQDGNRETYQCLAVSDDGLSFEKKGVVARLPEGYTAHFRDPKVWEHEGTWYMVIGAQT
ENLKGQAVLFASDNLTEWRFLGPITGAGFNGLDDFGYMWECPDLFSLQGSDVLIVSPQGL
EADGFRYQNVYQSGYFVGRLDYNKPELKHGEFTELDQGFDFYAPQTLEDDQGRRILFAWM
AVPDQDEGSHPTIDCHWIHCMTLPRQLTLSGQKLIQQPLPELKAMRRNEKKIHINMHGSS
GALPVEKPERTEILLEDIHTESGFSISIRGTATFSFHKDEGIVTLERKSFDGKRTEARHC
RIKDLHTVHMFLDASSVEIFINNGEEVLSARYFPFPGNHEVTASATGKSEMNVGIWTLM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacatgaccaggagcttcgtcgccgggcttatgaagaagtggagaaaaaagag
cccatcgctaacagcgatccgcaccgccagcattttcatatcatgccgccggttgggctg
ctgaatgacccgaatggcgtgatttattggaagggcagctatcatgtattctttcagtgg
cagccgtttcagacggggcacggcgcaaaattttgggggcattatacgacacaggatgtt
gtgaattggaagcgggaagagattgcgctggctccgagtgattggtttgataaaaacggc
tgctactcgggcagcgctgtcacgaaagacgatcggctctatcttttttacacaggaaat
gtcagggatcaggatggaaatcgggaaacgtatcaatgccttgctgtttctgacgacggg
ctgtcctttgagaaaaagggtgtcgtcgcccgccttccggaaggatatacggcgcatttt
cgcgatccgaaggtatgggagcatgaaggcacatggtatatggtgattggtgcgcaaaca
gagaatttgaaagggcaggctgtgttgtttgcttctgataacctgacagagtggagattt
cttggcccgataaccggcgcgggcttcaacgggctggacgattttggatacatgtgggaa
tgccctgatttgttttcccttcaaggatcggatgtgctgattgtttcgcctcaagggctt
gaggctgacggtttccgttatcagaacgtatatcaatcaggttattttgtcggccgcctc
gattataacaagcctgaactgaagcatggtgaatttacggagcttgatcaaggttttgat
ttttacgcgccgcaaacacttgaagacgatcagggaaggcggattttatttgcatggatg
gcggtgcctgatcaggatgaagggtcccatccgaccattgactgccactggattcactgc
atgacgctgccgagacagctgacgctttcaggacagaagctgattcagcagccgctgcct
gagctaaaagccatgcgcagaaatgagaaaaaaatacacatcaacatgcatggatcatct
ggtgcgcttccagtggaaaaacctgaaagaactgagattctactggaagacattcatacg
gagtctggcttttcaatcagtatccgcggaacggctacgttttccttccataaagacgag
gggattgttacgctggaacgaaagagctttgacggaaaaagaacagaagcgagacattgc
cgcatcaaggatttgcataccgtacacatgtttctcgacgcgtcatctgtggaaatcttt
atcaataacggagaagaggtcttgagtgcaagatattttcctttcccgggaaatcatgaa
gtaacagccagtgcgaccgggaaatctgaaatgaatgtcggaatttggacacttatgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system