KEGG   Bacillus subtilis subsp. subtilis 168: BSU38570Help
Entry
BSU38570          CDS       T00010                                 

Gene name
licA
Definition
(RefSeq) PTS system lichenan transporter subunit IIA
  KO
K02759  
PTS system, cellobiose-specific IIA component [EC:2.7.1.196 2.7.1.205]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Starch and sucrose metabolism
Phosphotransferase system (PTS)
Module
PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38570 (licA)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38570 (licA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     BSU38570 (licA)
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     BSU38570 (licA)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    BSU38570 (licA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(3959841..3960173)
Genome map
AA seq 110 aa AA seqDB search
MNEEMEQIIFQIILHGGNGRSSAMEAIAAAKSGDAEEARKKLQDAAEELSKAHHYQTELI
QNEAGGEKTEMTLLMVHAQDHLMNAMTVKDMAAEIIELYEKITEQRGASI
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaggaaatggaacaaatcatttttcaaatcatccttcacggaggaaacggtagg
agctccgcaatggaggccattgccgctgcgaaaagcggtgacgcagaagaagcgcggaaa
aagcttcaagacgctgctgaagaattgtcaaaagcccatcattatcagacagagctgatc
caaaatgaagcgggcggagaaaagacggaaatgacgcttctgatggttcatgcacaggat
catttaatgaatgcaatgacagtgaaggatatggctgcagagatcattgagttatatgaa
aaaatcaccgagcaaaggggagcaagcatatga

DBGET integrated database retrieval system