KEGG   Bacillus subtilis subsp. subtilis 168: BSU38770Help
Entry
BSU38770          CDS       T00010                                 

Gene name
cimH
Definition
(RefSeq) citrate/malate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
3979753..3981105
Genome map
AA seq 450 aa AA seqDB search
MGELQTHMQLQTDTIHEGVRKENWFAKAMNIKVGIIPLPVYALLFILITVFVMHHDVKSD
ILTSIAVMAFFGFTFAQIGKSIPIVRSIGGPAILATFIPSAVVYYHLLPNDIVKSTTEFT
ENSNFLYLFIAGIVVGSILGMKRETLVKAFMKIFIPLIVGSVTAAIVGLAVGTLLGLGFQ
HTLLYIVIPIMAGGVGEGAIPLSIGYSDIMPISQGEAFALVLPSIMLGSLCAIILAGLLN
RIGKKKPEWTGNGKVDRSEEESPALEESQSGQQMFNLSLFASGGILAVSLYLVGMLAHDF
FGFPAPVAMLLLAVLIKLFRLVPASIENGAFGVSRFFSTAVTYPLLFAIGVSMTPWDKLV
AAFNLSNIITILSVVVTMMAVGFFTGKWLNMYPIETAIINACHSGQGGTGDVAILSAAER
LELMPFAQVSTRIGGAITVSLTLLLLHQFY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcttcaaacacacatgcaattgcaaacggatacaattcacgaaggggttcga
aaagagaattggtttgcgaaagccatgaatataaaagtaggcatcataccgcttcctgtg
tatgccttgctgtttatattaatcactgtttttgttatgcatcacgatgtaaaaagtgac
attttgacatccattgccgtcatggcgtttttcgggtttacctttgcccaaatcggcaaa
tcgataccgattgttcgttctatcggcggcccggccatcctagctacttttattccgtcc
gctgtcgtgtactatcacctgctgcctaatgatatcgtcaaatccaccacagaatttaca
gaaaactcaaactttctatatttgtttatcgccggtattgtcgtcggaagcattctcggc
atgaaaagagaaacactcgtaaaagcattcatgaaaatctttattccgcttattgtcggt
tctgtcacagccgctattgtcggactggctgtcgggacattgctcggactcggatttcag
cataccctgctgtacattgtcattccgatcatggctggaggagtcggagaaggcgctatc
ccgctgtccatcggatattctgacatcatgcccatttctcaaggggaagcgtttgcactt
gttctgccatcgattatgctgggcagcttgtgcgcgattattctagcgggattgctgaac
cgaatcggaaagaaaaaaccggaatggacaggcaacggcaaagtggaccgctccgaagaa
gagtcccctgcgctggaggaatctcaaagcggacagcaaatgttcaacctttctttattt
gcgtcaggcggtatccttgctgtttctttatacttagtcggcatgctcgctcacgatttt
ttcggttttccggcacccgttgccatgctgttactggctgttctaatcaagctgttcaga
ttggtgcctgcctcaattgaaaatggcgcgtttggagtgtcccgcttcttttcaacagct
gtgacctacccgcttctctttgcgattggggtatccatgacgccgtgggacaagcttgtc
gccgcttttaacctcagcaatattatcacgattctgtctgtcgttgtgaccatgatggcc
gttggcttcttcactggaaaatggctgaacatgtatccgattgaaaccgccattattaat
gcatgccattctgggcaaggcggcacgggtgacgttgccattttaagcgccgctgaaagg
cttgagctaatgcctttcgcccaggtgtctacccgcatcgggggcgcgattacagtatcc
ttaaccttattgctgctgcaccagttttattga

DBGET integrated database retrieval system