KEGG   Bacillus subtilis subsp. subtilis 168: BSU38970Help
Entry
BSU38970          CDS       T00010                                 

Gene name
yxjF
Definition
oxidoreductase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bsu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bsu00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4000539..4001312)
Genome map
AA seq 257 aa AA seqDB search
MRKQVALVTGAAGGIGFEIAREFAREGASVIVSDLRPEACEKAASKLAEEGFDAAAIPYD
VTKEAQVADTVNVIQKQYGRLDILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMK
HVFPIMKKQQFGRIINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNAL
CPGYVDTQLVRNQLSDLSKTRNVPYDSVLEQVIFPLVPQKRLLSVKEIADYAVFLASEKA
KGVTGQAVVLDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacaagtcgctttggtgacaggggctgccggcggaatcggattcgaaatcgca
agagaattcgcccgggaaggtgccagcgtcatcgtttcagacctccgtccggaagcatgt
gaaaaagcagcctccaagcttgcagaagaaggctttgacgcggcggccattccgtatgat
gtgacaaaggaagcgcaagttgctgatacggtgaacgtcatccaaaaacaatacggccgc
ttggatattctggtgaacaatgccggtattcagcacgtcgctccgattgaagagtttccg
acagacacctttgaacagctgatcaaggtcatgctgacggctccctttattgcaatgaag
catgtttttccgatcatgaaaaaacagcagtttggcagaatcattaatattgcgtctgtt
aatggattagtgggctttgcagggaaatccgcttataatagcgccaagcacggcgtcatt
ggactcacaaaagtaggggcgctggaaggcgcgccccacggcataacagtcaatgcgctc
tgtccgggttatgtcgatacccagcttgtacgcaatcagcttagcgatctatcgaaaact
agaaatgtcccttacgactctgtacttgaacaagtcatttttccgcttgtgccgcaaaag
cgactgctttccgtcaaggaaattgcggattatgccgtgtttttggcaagcgagaaggcg
aagggcgtcactgggcaggctgtcgtccttgatgggggctacaccgcacaatga

DBGET integrated database retrieval system