KEGG   Bacillus subtilis subsp. subtilis 168: BSU38970Help
Entry
BSU38970          CDS       T00010                                 

Gene name
yxjF
Definition
oxidoreductase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU38970 (yxjF)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BSU38970 (yxjF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BSU38970 (yxjF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4000539..4001312)
Genome map
AA seq 257 aa AA seqDB search
MRKQVALVTGAAGGIGFEIAREFAREGASVIVSDLRPEACEKAASKLAEEGFDAAAIPYD
VTKEAQVADTVNVIQKQYGRLDILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMK
HVFPIMKKQQFGRIINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNAL
CPGYVDTQLVRNQLSDLSKTRNVPYDSVLEQVIFPLVPQKRLLSVKEIADYAVFLASEKA
KGVTGQAVVLDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacaagtcgctttggtgacaggggctgccggcggaatcggattcgaaatcgca
agagaattcgcccgggaaggtgccagcgtcatcgtttcagacctccgtccggaagcatgt
gaaaaagcagcctccaagcttgcagaagaaggctttgacgcggcggccattccgtatgat
gtgacaaaggaagcgcaagttgctgatacggtgaacgtcatccaaaaacaatacggccgc
ttggatattctggtgaacaatgccggtattcagcacgtcgctccgattgaagagtttccg
acagacacctttgaacagctgatcaaggtcatgctgacggctccctttattgcaatgaag
catgtttttccgatcatgaaaaaacagcagtttggcagaatcattaatattgcgtctgtt
aatggattagtgggctttgcagggaaatccgcttataatagcgccaagcacggcgtcatt
ggactcacaaaagtaggggcgctggaaggcgcgccccacggcataacagtcaatgcgctc
tgtccgggttatgtcgatacccagcttgtacgcaatcagcttagcgatctatcgaaaact
agaaatgtcccttacgactctgtacttgaacaagtcatttttccgcttgtgccgcaaaag
cgactgctttccgtcaaggaaattgcggattatgccgtgtttttggcaagcgagaaggcg
aagggcgtcactgggcaggctgtcgtccttgatgggggctacaccgcacaatga

DBGET integrated database retrieval system