KEGG   Bacillus subtilis subsp. subtilis 168: BSU39020Help
Entry
BSU39020          CDS       T00010                                 

Gene name
yxjA
Definition
(RefSeq) purine nucleoside transport protein NupG
  KO
K16323  
purine nucleoside transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU39020 (yxjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
4005752..4006945
Genome map
AA seq 397 aa AA seqDB search
MYFLLNLVGLIVIMAVVFLCSPQKKKIKWRPIITLIVLELLITWFMLGTKVGSWAIGKIG
DFFTWLIACASDGIAFAFPSVMANETVDFFFSALLPIIFIVTFFDILTYFGILPWLIDKI
GWVISKASRLPKLESFFSIQMMFLGNTEALAVIRQQLTVLSNNRLLTFGLMSMSSISGSI
IGSYLSMVPATYVFTAIPLNCLNALIIANLLNPVHVPEDEDIIYTPPKEEKKDFFSTISN
SMLVGMNMVIVILAMVIGYVALTSAVNGILGVFVHGLTIQTIFAYLFSPFAFLLGLPVHD
AMYVAQLMGMKLATNEFVAMLDLKNNLKSLPPHTVAVATTFLTSFANFSTVGMIYGTYNS
ILDGEKSTVIGRNVWKLLVSGIAVSLLSAAIVGLFVW
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtactttttactaaaccttgtcggtctcattgtgattatggcagttgtattcctatgt
tctccgcagaaaaagaaaatcaagtggcgcccgatcattacgttaattgttctggaattg
ctgattacttggtttatgctgggaacaaaagtcggaagctgggccatcggtaaaatcggt
gatttcttcacttggctgattgcttgcgccagtgacggtatcgcgtttgcctttccgtca
gtgatggcgaatgaaacagtagactttttctttagtgcgcttcttccaattatctttatc
gtcacattctttgatattttaacgtatttcggcattttgccttggctgattgataaaatc
ggatgggtgatttcaaaggcttcccgcttgccgaaattagaaagctttttctctattcaa
atgatgttccttggaaataccgaagcacttgcggtcatccgccagcagcttacggtttta
agcaacaaccgcctgctcacattcggtttaatgagcatgagcagcatcagcggctccatt
atcggatcttatctttcaatggtgcctgcgacatacgtgtttacagccattcctttgaac
tgcttaaacgcgctgattatcgcaaacctgctgaatcctgttcacgtgccggaggatgaa
gatatcatctatacaccgcctaaagaagagaagaaagactttttctctacgatttctaac
agtatgcttgtcggcatgaacatggttatcgttattttggcaatggtgatcggatatgtc
gcattaacgtcagcagttaatggcattcttggcgttttcgtacatggcctgaccatccag
acaatttttgcttatctgttcagtccgttcgcattcctgcttggactgccagtgcacgat
gcgatgtatgttgctcagctgatgggcatgaaattagcaacgaacgagtttgttgcgatg
cttgacttgaaaaacaatctcaaatcccttccgcctcacaccgttgcggtggcgacgaca
ttcctgacgtcctttgcaaacttcagtactgtcggcatgatttacggcacgtacaattcg
atccttgacggagaaaagtcaacggtcatcgggagaaacgtgtggaaactgctcgtcagc
ggaattgcggtatctttattaagtgctgcgattgtcggcctgtttgtgtggtag

DBGET integrated database retrieval system