KEGG   Bacillus subtilis subsp. subtilis 168: BSU39070Help
Entry
BSU39070          CDS       T00010                                 

Gene name
bglS
Definition
(RefSeq) beta-glucanase (EC:3.2.1.73)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4011842..4012570)
Genome map
AA seq 242 aa AA seqDB search
MPYLKRVLLLLVTGLFMSLFAVTATASAQTGGSFFDPFNGYNSGFWQKADGYSNGNMFNC
TWRANNVSMTSLGEMRLALTSPAYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFF
TYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKIVDLGFDAANAYHTYAFDWQ
PNSIKWYVDGQLKHTATNQIPTTPGKIMMNLWNGTGVDEWLGSYNGVNPLYAHYDWVRYT
KK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgccttatctgaaacgagtgttgctgcttcttgtcactggattgtttatgagtttgttt
gcagtcactgctactgcctcagctcaaacaggtggatcgttttttgacccttttaacggc
tataactccggtttttggcaaaaagcagatggttattcgaatggaaatatgttcaactgc
acgtggcgggctaataacgtatcaatgacgtcattgggtgaaatgcgtttagcgctaaca
agcccagcttataacaagtttgactgcggggaaaaccgttctgttcaaacatatggctat
ggactttatgaagtcagaatgaaaccagctaaaaacacagggatcgtttcatcgttcttc
acttacacaggtccaacagatggaactccttgggatgagattgatatcgaatttttagga
aaagacacaacgaaggttcaatttaactattatacaaatggtgcaggaaaccatgagaag
attgttgatctcgggtttgatgcagccaatgcctatcatacgtatgcattcgattggcag
ccaaactctattaaatggtatgtcgacgggcaattaaaacatactgcaacaaaccaaatt
ccgacaacacctggaaagatcatgatgaacttgtggaatggcacgggtgtcgatgaatgg
cttggctcctacaatggtgtaaatccgctatacgctcattatgactgggtgcgctataca
aaaaaataa

DBGET integrated database retrieval system