KEGG   Bacillus subtilis subsp. subtilis 168: BSU39240Help
Entry
BSU39240          CDS       T00010                                 

Gene name
yxxF
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4030710..4031645)
Genome map
AA seq 311 aa AA seqDB search
MQQDPSISSKQKSTAVIKMVISMVIFGSIGFFSEHTNLPSFELVFVRCLCATLFLGFCWL
ASGQYKTEKWSKRDVLQTLACGFFLVFNWVFLFKSFEETSVTIAISVYHLAPVLVLLLGS
FFYREKLNVISVSSIIICFLGTALISGINGSTSLTQLMGSGIIWAVLAALFYAFTTLLGK
GIHNLSPYTTTFLQTGLGVIILIPFIHFGAFADLSQGNWIMVVSTGIIHTGIVYLLFFDS
LRFLSTKFISIIVFLDPAVAIVLDTVFTGFRPDLYQTLGIVMIFAGMALTLVRRQGKANV
TAEGTDIEQIQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggatccttccatatcgtcaaaacaaaaatcaacagccgtaatcaaaatggtc
atctctatggtgattttcggctccatcggctttttctcagagcataccaatctgccgtca
tttgaattggtctttgtccgctgcctttgcgcgacgctgtttttaggcttttgctggctg
gcgtccggccagtataaaactgaaaaatggagcaagagagacgtgctgcaaacattggcg
tgcggtttctttcttgtattcaactgggtgttcttatttaagtcttttgaagaaacgtcc
gttacaattgccatctctgtttatcatctagcgccggtgcttgttcttcttctggggagc
ttcttctacagagagaaattaaatgtgatctccgtcagctccattatcatctgctttctt
gggactgcgctgatttccgggattaacggcagcacatcattgacacagctgatgggatca
gggatcatatgggcagttctcgccgcactgttttatgcgttcaccactttattgggaaaa
ggcattcacaatctcagtccttacacgaccaccttcttgcagacaggtttaggggttatc
atcctgattccgtttattcactttggcgcttttgcggacctatctcagggaaactggatt
atggtggtatctaccggcatcatccatacgggtattgtatatttgctgttttttgacagt
ttacgatttttatcaacgaaatttatttcaatcattgtatttctcgaccccgctgtcgcg
atcgtgctcgataccgtcttcacaggcttccgccctgacctctatcaaacgcttggcatc
gtaatgatctttgcgggcatggccttgacgcttgtcaggaggcaggggaaggcgaatgtg
acagctgagggtacggatattgaacaaatacaataa

DBGET integrated database retrieval system