KEGG   Bacillus subtilis subsp. subtilis 168: BSU39260Help
Entry
BSU39260          CDS       T00010                                 

Gene name
bglH
Definition
aryl-phospho-beta-d-glucosidase BglH (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU39260 (bglH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU39260 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4032346..4033755)
Genome map
AA seq 469 aa AA seqDB search
MSSNEKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPFDESMTSLNLYHN
GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLRFYDDLFDELLKHH
IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL
HAPFTGGGLVFEEGENKLNAMYQAAHHQFVASALAVKAGHDIIPDSKIGCMIAATTTYPM
TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD
YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY
QKPLFIVENGLGAVDKVEEDGTIQDDYRINYLRDHLIEAREAIADGVELIGYTSWGPIDL
VSASTAEMKKRYGFIYVDRDNEGNGTFNRIKKKSFNWYQQVIATNGESL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaatgaaaaacgatttccagaaggatttttatggggcggcgcagttgctgcc
aaccaagtggagggtgcttataacgagggtggtaaggggctttcgacagctgacgtatcg
ccgaacgggatcatgtctccatttgatgaatcaatgacttccttgaatctgtatcacaac
gggattgacttttatcatcgttataaagaggatatcgccttatttgcagaaatgggattt
aaggcgttccgcacatcgattgcgtggacgagaatttttccgaatggcgatgaagaggag
cccaatgaagaaggcctcagattttatgatgatctgtttgatgagctgttaaagcatcat
attgagcctgtcgtaaccatctctcattatgagatgccgctcggtttagtgaaaaattat
ggcggctggaagaatcgcaaagtcatagagttttatgaacgctatgccaaaacggttttc
aaacgctatcaacacaaagtgaagtattggatgacgtttaatgaaattaacgtagtgctc
catgcgccatttaccggaggcggtcttgtttttgaagaaggagaaaacaaattaaacgcg
atgtaccaggcggcacaccaccaatttgtggccagtgctcttgctgtcaaagcgggtcac
gacatcattcctgattcgaaaatcggctgtatgatagcggcaacgacaacctatccgatg
acttctaagccggaggatgtcttcgcggcaatggagaatgagcgcaaaacacttttcttc
tcagatgttcaggcaagaggcgcatacccgggatatatgaaacgctatctggcagaaaac
aatattgaaattgaaatggctgaaggcgatgaagagctcttgaaagaacatacggtggat
tatattggatttagctactacatgtcgatggcggcgagcacagatccggaagagcttgca
aaatcagggggcaacctgctgggcggagtcaaaaacccttacctcaaatcatcagaatgg
ggctggcagattgatccgaaaggcttgcgcatcacgctcaacaccttatacgaccgttac
cagaagccgctgttcatcgttgaaaacggccttggcgctgtagacaaggttgaagaggac
ggcacgattcaggacgattacagaatcaactatctgcgtgatcatttaattgaagcgcgc
gaagccattgcggacggcgttgaattaatcggatacacatcatgggggccaattgacctt
gtcagcgcatctactgcggaaatgaaaaagcgctacggcttcatttatgtagaccgggac
aatgaaggaaatggaacatttaaccgcatcaagaaaaaaagcttcaactggtatcagcag
gttatcgccacaaacggagagagtctctga

DBGET integrated database retrieval system