KEGG   Bacillus subtilis subsp. subtilis 168: BSU39480Help
Entry
BSU39480          CDS       T00010                                 

Gene name
yxeO
Definition
(RefSeq) amino acid import ATP-binding protein YxeO
  KO
K16963  
putative amino-acid transport system ATP-binding protein [EC:3.6.3.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
ABC transporters
Module
Putative amino-acid transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BSU39480 (yxeO)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BSU39480 (yxeO)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative amino-acid transporter [MD:M00586] [OT]
    BSU39480 (yxeO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4058029..4058778)
Genome map
AA seq 249 aa AA seqDB search
MITVKNIRKAFKDLVVLDGIDLEVKRGEVVAIIGPSGSGKSTLLRCLNLLERPDQGLIEI
GEAKLNAEKFTRKEAHRLRQQTAMVFQNYNLFKNKTALQNITEALIVAQHKPRDEAKRIG
MEILKQVGLEHKADSYPITMSGGQQQRIGIARALAVNPHAILLDEPTSALDPELVTGVLQ
VIKSIAEKQTTMIIVTHEMAFAKEVADQVIFMADGHIIEQGTPEELFDHPKNERTKRFIK
QVGEPAELI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgataacagtaaaaaatattcgcaaagcgtttaaagatctcgtcgtgctcgacggaatc
gatctagaagtgaaacgcggagaagtggtggcaatcatcggtccgtccggttccggaaaa
tcaacgcttctccggtgcttaaatctattagagcgtccggatcaaggccttattgaaatc
ggagaagccaaactgaatgcggaaaagtttacacgcaaggaagcacatcggcttcgccag
caaacggccatggtctttcaaaactacaatctgtttaaaaataaaacggctctgcaaaac
attacagaagctttaatcgtggctcaacataaaccacgcgacgaagcgaaacgtattgga
atggagattctgaaacaagtcggtctggagcataaggctgacagctatccaatcacaatg
tccggcggccagcagcagcgaatcggcattgcgcgggcgcttgcggtcaatccgcatgcg
attttgctggatgaaccaacgtcagcgcttgaccctgagctcgtcacaggggtgcttcag
gtcatcaagtccattgcggaaaaacaaacaacgatgatcattgttacacacgaaatggcg
tttgcaaaagaggttgctgatcaagtgatttttatggcagacggccatattatcgagcag
ggaacgccagaggaactgtttgaccatccgaaaaacgaacggacgaaacgatttatcaag
caggtgggagagcctgcagagcttatataa

DBGET integrated database retrieval system