KEGG   Bacillus subtilis subsp. subtilis 168: BSU39520Help
Entry
BSU39520          CDS       T00010                                 

Gene name
yxeK
Definition
(RefSeq) monooxygenase YxeK (EC:1.14.-.-)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4060818..4062143)
Genome map
AA seq 441 aa AA seqDB search
MTSKKKQIKLGVFLAGTGHHVASWRHPDAPSDASMNLDYFKELAKTAERGKLDMLFLADS
LSIDSKSHPNVLTRFEPFTLLSALAQVTSKIGLTATASTTYSEPFHIARQFASLDHLSNG
RAGWNVVTSSIESTALNFSGEKHLEHHLRYQRAEEFVEIVKGLWDSWEEDAFIRNKETGE
FFDKEKMHELNHKGEYFSVRGPLNVSRTPQGQPVIIQAGSSGDGKALAAKTAEVIFTAQN
HLESAQEFYQSIKEQAAEFGRDPEKIAIMPGIFPIIADTEEAAQAKYKELQDLIIPSVGL
QILQNYLGGIDLSAYPLDGPLPKLDAEASNAVKSRFKLVQEMAERDNMTIRELYKYVAGS
RGHHIFVGTPEQLADKMQEWVDTKACDGFNIMPPLLPEGIEVFVDQVVPILQERGVFRKE
YEGTTLREHFGLEKPVNRYAK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaaagaaacaaatcaaattaggggtatttttagcaggtacaggccatcat
gttgcgtcttggcggcacccggacgcgccgtcagatgcgagcatgaatttggattatttt
aaagagcttgcgaaaacagcggagcgaggcaagctggatatgctgtttttagcggacagc
ctttcaattgacagcaaatcacatccaaatgtattaacaaggtttgagccattcaccctg
ctctctgctttggcgcaggtcacatcaaaaatcggactgacagcaacagcctccactaca
tacagcgagccattccatattgccagacagtttgcgtcattggatcatctgtccaatggc
cgtgccggatggaacgtcgtcacttcatctattgaatcaacagcgctgaatttcagcggt
gaaaagcaccttgaacaccatttgcgctatcagcgggcagaggaatttgtcgagattgta
aaggggctttgggattcatgggaagaggacgcctttatccgtaataaagaaacgggtgaa
ttctttgacaaagaaaaaatgcatgagctgaaccacaaaggagaatatttctcggttcgc
ggacctctaaacgtttcaagaaccccgcagggccagccggtcattatccaggcaggatca
tcaggagacggaaaagcgctggctgccaaaacagccgaagtgatcttcacagcacaaaac
cacctggaatcagctcaagaattttatcaatccattaaagaacaggctgcggaattcgga
cgtgatccagaaaaaattgccattatgccgggtattttcccaatcattgccgatacagaa
gaagcagcgcaagccaaatacaaggagctccaagatctgattatcccatctgtcggtctg
caaattctccaaaattacttaggcggaattgatttgtcggcatatccgcttgatgggccg
ctgccgaagcttgacgccgaagcttccaatgcggtgaagagccgcttcaagcttgttcag
gagatggctgaacgtgacaatatgacgatacgagagctttacaaatacgttgcaggctcc
agaggccaccatatcttcgtcggcacgccggagcagctcgccgacaagatgcaggaatgg
gtggatacgaaagcgtgtgacgggtttaacatcatgcctccgcttcttccagaaggaatt
gaagtgtttgttgatcaagtggttccgattttacaggagcgcggcgtgttcagaaaagaa
tatgaaggcacaacattacgagagcacttcggtttggaaaagccggtaaaccgctatgca
aagtaa

DBGET integrated database retrieval system