KEGG   Bacillus subtilis subsp. subtilis 168: BSU40070Help
Entry
BSU40070          CDS       T00010                                 

Gene name
gntP
Definition
(RefSeq) gluconate permease
  KO
K03299  
gluconate:H+ symporter, GntP family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU40070 (gntP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
4115711..4117057
Genome map
AA seq 448 aa AA seqDB search
MPLIIVALGILALLFLIMGLKLNTFISLLVVSFGVALALGMPFDKVVSSIEAGIGGTLGH
IALIFGLGAMLGKLIADSGGAQRIAMTLVNKFGEKNIQWAVVIASFIIGIALFFEVGLVL
LIPIVFAISRELKISILFLGIPMVAALSVTHGFLPPHPGPTAIAGEYGANIGEVLLYGFI
VAVPTVLIAGPLFTKFAKKIVPASFAKNGNIASLGTQKTFNLEETPGFGISVFTAMLPII
IMSVATIIDLLQETIGFADNGVLAFIRLIGNASTAMIISLLVAVYTMGIKRNIPVKTVMD
SCSTAISQIGMMLLIIGGGGAFKQVLINGGVGDYVADLFKGTALSPIILAWLIAAILRIS
LGSATVAALSTTGLVIPLLGHSDVNLALVVLATGAGSVIASHVNDAGFWMFKEYFGLSMK
ETFATWTLLETIISVAGLGFILLLSLVV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgccgttaatcatcgttgcacttgggatcttagcattactatttctgattatgggctta
aaattaaacacatttatttccctgctggtcgtatcgttcggcgtggcactggcactcggg
atgccgttcgataaagttgtcagctccatcgaagcaggaataggggggactcttggccac
atcgcgctcatcttcggactcggtgcgatgctgggcaaactgatcgcggattcaggaggc
gcacagcgcattgcgatgacgctcgtcaacaaattcggtgagaaaaatattcaatgggcc
gttgtcattgcctcattcattattgggattgcgttattttttgaagtaggactggttcta
ttaattccgattgtctttgcgatttcaagagaattgaagatttctattttatttctcgga
atcccgatggtcgcggcactatccgtcacacacggtttcctgccgccgcacccgggacct
acggcgatcgccggtgagtatggcgcaaacattggagaagtgctgctgtacggctttatc
gttgctgttccgacagtgctcattgcagggccgttatttacaaagttcgcgaaaaaaatc
gttcctgcatcatttgcgaaaaacggcaatattgcatcactcggcacacaaaaaacattt
aaccttgaagaaacacccggctttggaatcagtgtctttactgcaatgctcccgattatc
atcatgtcggtcgcgaccattatcgacctgcttcaagaaacaatcgggtttgcagataac
ggagttttagcttttatcagattgattggaaacgcatcgactgctatgattatttcgtta
ttggtcgcagtctatacaatgggcatcaagcgcaacattccagtcaaaaccgtgatggat
tcttgttcaactgccatttcacaaatcggcatgatgcttttgatcatcggaggaggcggc
gccttcaaacaagtgctgatcaacggcggtgtcggcgattacgtagcagacttattcaaa
ggaacggcattatcgccaatcattctggcatggctcatcgcagcgatcctgcgcatttct
ctaggatcggcgactgttgccgcactaagcacaacaggtctggtcattccgttattgggc
cattctgatgttaacctggcgttagtcgtactcgcaacaggagccggaagtgtcatcgct
tcacacgtcaatgacgccggcttctggatgttcaaggaatacttcggattaagcatgaaa
gaaacattcgccacatggacattgctggaaaccattatttccgttgctggactgggattc
attttattgttaagtttagttgtatga

DBGET integrated database retrieval system