KEGG   Bacillus subtilis subsp. subtilis 168: BSU40190Help
Entry
BSU40190          CDS       T00010                                 

Gene name
fbp
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00030  Pentose phosphate pathway
bsu00051  Fructose and mannose metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU40190 (fbp)
   00030 Pentose phosphate pathway
    BSU40190 (fbp)
   00051 Fructose and mannose metabolism
    BSU40190 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BSU40190 (fbp)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BSU40190 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 937744
NCBI-ProteinID: NP_391899
Pasteur: BG11478
BSORF: BG11478
UniProt: Q45597
Position
4128029..4130044
Genome map
AA seq 671 aa AA seqDB search
MFKNNVILLNSPYHAHAHKEGFILKRGWTVLESKYLDLLAQKYDCEEKVVTEIINLKAIL
NLPKGTEHFVSDLHGEYQAFQHVLRNGSGRVKEKIRDIFSGVIYDREIDELAALVYYPED
KLKLIKHDFDAKEALNEWYKETIHRMIKLVSYCSSKYTRSKLRKALPAQFAYITEELLYK
TEQAGNKEQYYSEIIDQIIELGQADKLITGLAYSVQRLVVDHLHVVGDIYDRGPQPDRIM
EELINYHSVDIQWGNHDVLWIGAYSGSKVCLANIIRICARYDNLDIIEDVYGINLRPLLN
LAEKYYDDNPAFRPKADENRPEDEIKQITKIHQAIAMIQFKLESPIIKRRPNFNMEERLL
LEKIDYDKNEITLNGKTYQLENTCFATINPEQPDQLLEEEAEVIDKLLFSVQHSEKLGRH
MNFMMKKGSLYLKYNGNLLIHGCIPVDENGNMETMMIEDKPYAGRELLDVFERFLREAFA
HPEETDDLATDMAWYLWTGEYSSLFGKRAMTTFERYFIKEKETHKEKKNPYYYLREDEAT
CRNILAEFGLNPDHGHIINGHTPVKEIEGEDPIKANGKMIVIDGGFSKAYQSTTGIAGYT
LLYNSYGMQLVAHKHFNSKAEVLSTGTDVLTVKRLVDKELERKKVKETNVGEELLQEVAI
LESLREYRYMK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaataatgtcatacttttaaattcaccttatcatgcacatgctcataaagag
gggtttattctaaaaaggggatggacggttttggaaagcaagtacctagatctactcgca
caaaaatacgattgtgaagaaaaagtggtaacagaaatcatcaatttgaaagcgatattg
aacctgccaaaaggcaccgagcattttgtcagtgatctgcacggagagtatcaggcattc
cagcacgtgttgcgcaatggttcaggacgagtcaaagagaagatacgcgacatcttcagc
ggtgtcatttacgatagagaaattgatgaattagcagcattggtctattatccggaagac
aaactgaaattaatcaaacatgactttgatgcgaaagaagcgttaaacgagtggtataaa
gaaacgattcatcgaatgattaagctcgtttcatattgctcctctaagtatacccgctcc
aaattacgcaaagcactgcctgcccaatttgcttatattacggaggagctgttatacaaa
acagaacaagctggcaacaaggagcaatattactccgaaatcattgatcagatcattgaa
cttggccaagccgataagctgatcaccggccttgcttacagcgttcagcgattggtggtc
gaccatctgcatgtggtcggcgatatttatgaccgcggcccgcagccggatagaattatg
gaagaactgatcaactatcattctgtcgatattcagtggggaaatcacgatgtcctttgg
atcggcgcctattccggttccaaagtgtgcctggccaatattatccgcatctgtgcccgc
tacgacaacctggatattattgaggacgtgtacggcatcaacctgagaccgctgctgaac
ctggccgaaaaatattatgatgataatccagcgttccgtccaaaagcagacgaaaacagg
ccagaggatgagattaagcaaatcacaaaaatccatcaagcgattgccatgatccaattc
aagcttgagagcccgattatcaagagacggccgaactttaatatggaagagcggctgtta
ttagagaaaatagactatgacaaaaatgaaatcacgctgaacggaaaaacatatcaactg
gaaaacacctgctttgcgacgattaatccggagcagccagatcagctattagaagaagaa
gcagaagtcatagacaagctgctattctctgtccagcattccgaaaagctgggccgccat
atgaattttatgatgaaaaaaggcagcctttatttaaaatataacggcaacctgttgatt
cacggctgtattccagttgatgaaaacggcaatatggaaacgatgatgattgaggataaa
ccgtatgcgggccgtgagctgctcgatgtatttgaacgattcttgcgggaagcctttgcc
cacccggaagaaaccgatgacctggcgacagatatggcttggtatttatggacaggcgaa
tactcctccctcttcggaaaacgcgccatgacgacatttgagcgctatttcatcaaagag
aaggaaacgcataaagagaagaaaaacccgtattattatttacgagaagacgaggcaacc
tgccgaaacatcctggcagaattcggcctcaatccagatcacggccatatcatcaacggc
catacacctgtaaaagaaatcgaaggagaagacccaatcaaagcaaacggaaaaatgatc
gtcatcgacggcggcttctccaaagcctaccaatccacaacaggcatcgccggctacacg
ctgctatacaactcctacggcatgcagctcgtcgcccataaacacttcaattccaaggca
gaagtcctaagcaccggaaccgacgtcttaacggtcaaacgattagtggacaaagagctt
gagcggaagaaagtgaaggaaacgaatgtgggtgaggaattgttgcaggaagttgcgatt
ttagagagtttgcgggagtatcggtatatgaagtga

DBGET integrated database retrieval system