KEGG   Bacillus subtilis subsp. subtilis 168: BSU40320Help
Entry
BSU40320          CDS       T00010                                 

Gene name
argI
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4141711..4142601)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggatatgggcccgagtgccatccggtacgctcatctgatcgagaggctgtcagacatg
gggtatacggttgaagatctcggtgacattccgatcaatcgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatttgaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctaggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgtcatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgatcgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccatttggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacgggc
aaaacagcagtagagctcgtagaatccctgttagggaagaagctgctgtaa

DBGET integrated database retrieval system