KEGG   Bacillus subtilis subsp. subtilis 168: BSU40330Help
Entry
BSU40330          CDS       T00010                                 

Gene name
rocE
Definition
(RefSeq) amino acid permease RocE
  KO
K02205  
arginine/ornithine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU40330 (rocE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4142675..4144078)
Genome map
AA seq 467 aa AA seqDB search
MNTNQDNGNQLQRTMKSRHLFMISLGGVIGTGFFLGTGFTINQAGPLGAVLSYLVGGFIM
FLTMLCLGELAVAFPVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQLMQ
RWFPHIDVWIWCLVFAALMFILNAITTKAFAESEFWFSGIKILIILLFIILGGAAMFGLI
DLKGGEQAPFLTHFYEDGLFPNGIKAMLITMITVNFAFQGTELIGVAAGESEDPEKTIPR
SIKQTVWRTLVFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIPYAADIMNFVILIAL
LSVANSGLYASTRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKFAQAE
TVYMVLLSLAGMSAQVGWITISLSQIMFRRKYIREGGKIEDLKFKTPLYPVLPLIGLTLN
TVVLISLAFDPEQRIALYCGVPFMIICYIIYHVVIKKRQQANRQLEL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacaaaccaagataacggaaatcagctccagcggacaatgaaatcacgccatttg
ttcatgatttcattgggcggagtgatcggaaccggtttcttccttggaaccgggtttacc
attaaccaagcgggaccgctcggcgcggttctgtcctatttagtgggcggctttatcatg
tttttgaccatgctctgcttaggagagctggcagtcgcctttcctgtgtcggggtccttc
cagacctatgccacgaaatttatcagcccggccttcgggtttgcgttcggctggctgtac
tggctcggctgggcggttacatgcgccattgaatttttatcagcggggcagctgatgcaa
cgctggtttccgcatatagacgtgtggatctggtgtctggtctttgcggcactgatgttt
attttaaatgcgatcaccacaaaagcctttgcggaatctgaattctggttctcaggcatt
aaaattttgattatccttttatttattattctcggcggagctgccatgtttggcctgatt
gatctgaagggcggagagcaggcgccgtttttgacacatttttatgaagacgggttattt
ccgaacggcataaaggcaatgctgattacgatgattactgtgaactttgcgtttcagggg
actgagctgatcggggttgcagccggagaaagtgaagaccctgaaaaaacgattccgcgg
tccatcaaacagacagtatggagaacgcttgtgttctttgtgctttcaatcattgtcatt
gccggcatgattccgtggaaacaggcgggtgtcgtggaaagtccatttgttgccgtattt
gagcaaatcggaatcccatatgcagctgatatcatgaactttgttattttaatcgcactg
ttatctgttgcgaactcaggtttatacgcatcaacacgtattctgtacgcgatggcgaat
gaaggacaagccttcaaagcgcttggcaaaacaaatcagcgcggtgtaccgatgtactcg
ttaatcgtaacgatggctgtggcctgcctatcacttctgacaaagtttgcgcaggctgaa
accgtatatatggtactgttatctttggcgggcatgagcgcgcaggtcggctggattacg
atctcgctttcccaaatcatgttcagacgcaaatatatccgtgagggcgggaagatagaa
gatttgaaatttaaaacaccgctgtacccggtgcttccgctgatcggcctaacgttaaat
acggtcgtgctcatcagtcttgcatttgatccggagcagcgtatcgcgctgtattgcggc
gtaccgtttatgatcatttgctacatcatttatcatgtcgtcattaaaaaacgccagcag
gcaaatcgtcagctagagctttaa

DBGET integrated database retrieval system