KEGG   Bacillus subtilis subsp. subtilis 168: BSU40410Help
Entry
BSU40410          CDS       T00010                                 

Gene name
walR
Definition
(RefSeq) transcriptional regulator
  KO
K07668  
two-component system, OmpR family, response regulator VicR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Two-component system
Module
VicK-VicR (cell wall metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU40410 (walR)
Two-component system [BR:bsu02022]
 OmpR family
  VicK-VicR [MD:M00459]
   BSU40410 (walR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4153696..4154403)
Genome map
AA seq 235 aa AA seqDB search
MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKD
GVEVCREVRKKYDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQ
LTTAPAEEEPSSNEIHIGSLVIFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTRE
HLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaagatccttgtagtagatgatgaaaaaccgattgcagatatattggaattt
aacttaagaaaagaaggctatgaagtgcactgtgcccacgacggaaacgaagccgttgaa
atggtagaagagcttcagcctgatttaattcttttagatattatgctcccaaataaagac
ggcgttgaagtatgccgcgaagtcagaaagaaatacgatatgccaatcattatgctgacg
gctaaggattcagaaattgacaaggttatcgggcttgaaatcggtgctgatgactatgtc
acaaaaccattcagcacacgcgagctcttggcgcgtgtaaaagcgaacctgcgccgccag
ctgacaacagcgcctgcggaggaagagccttcctctaacgagattcatatcggctctctc
gtcatcttccctgacgcgtacgttgtatcaaaacgagacgaaacaatcgaattgactcat
cgtgagttcgaattgcttcattatttagcaaaacatatcggacaagtgatgacccgtgaa
catttgcttcaaaccgtttggggctatgattacttcggcgatgtcagaacggttgacgta
acagtccgccggcttcgtgaaaaaatcgaggacaacccgagccatccaaattggatcgtc
acacgccgtggtgtaggttattacttgagaaacccagaacaggactaa

DBGET integrated database retrieval system