KEGG   Bacillus subtilis subsp. subtilis 168: BSU41040Help
Entry
BSU41040          CDS       T00010                                 

Gene name
spoIIIJ
Definition
(RefSeq) membrane protein insertase MisCA
  KO
K03217  
YidC/Oxa1 family membrane protein insertase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    BSU41040 (spoIIIJ)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    BSU41040 (spoIIIJ)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU41040 (spoIIIJ)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   BSU41040 (spoIIIJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Position
complement(4213823..4214608)
Genome map
AA seq 261 aa AA seqDB search
MLLKRRIGLLLSMVGVFMLLAGCSSVKEPITADSPHFWDKYVVYPLSELITYVAKLTGDN
YGLSIILVTILIRLLILPLMIKQLRSSKAMQALQPEMQKLKEKYSSKDQKTQQKLQQETM
ALFQKHGVNPLAGCFPILIQMPILIGFYHAIMRTQAISEHSFLWFDLGEKDPYYILPIVA
GVATFVQQKLMMAGNAQQNPQMAMMLWIMPIMIIVFAINFPAALSLYWVVGNLFMIAQTF
LIKGPDIKKNPEPQKAGGKKK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgaaaaggagaatagggttgctattaagtatggttggcgtattcatgcttttg
gctggatgctcgagtgtgaaagagccgatcactgcagatagtccgcatttctgggacaag
tacgtagtatatccattgtctgagctcattacgtatgtagcgaaattgacgggagataac
tacgggctttcaattattctagttaccattttaattcgtttattaattttaccgctgatg
attaagcagctgagaagttcgaaagcgatgcaggctttacagccggaaatgcaaaagctt
aaagaaaaatacagctcaaaggatcaaaaaacgcagcaaaagcttcaacaggaaacaatg
gctttattccaaaagcatggtgtcaatccattggcgggatgtttcccgattttgatccag
atgccgattttaattggattctatcatgcgatcatgagaacccaggcgatttcagagcat
agcttcttatggtttgacttaggagaaaaagatccttactatattcttcctatcgttgcc
ggtgtcgctacatttgttcagcaaaaactgatgatggctggcaatgcgcagcaaaatccg
caaatggcgatgatgctttggattatgccaattatgattatcgtatttgcgatcaacttc
ccggcggctctttctctttattgggtagttggtaacttgtttatgattgcgcaaactttc
ctcattaaaggacctgatattaaaaaaaatcctgagccgcaaaaagccggaggaaagaaa
aagtga

DBGET integrated database retrieval system