KEGG   Bacillus subtilis BEST7613: BEST7613_0165Help
Entry
BEST7613_0165     CDS       T02410                                 

Gene name
ybbD
Definition
beta-hexosaminidase, lipoprotein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BEST7613_0165 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BEST7613_0165 (ybbD)
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BEST7613_0165 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(186449..188377)
Genome map
AA seq 642 aa AA seqDB search
MRPVFPLILSAVLFLSCFFGARQTEASASKRAIDANQIVNRMSLDEKLGQMLMPDFRNWQ
KEGESSPQALTKMNDEVASLVKKYQFGGIILFAENVKTTKQTVQLTDDYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKELSALGINTDFSPVVDIN
NNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPASVTSLKEEQK
FARVIQALKEAVKNGDIPEQQINNSVERIISLKIKRGMYPARNSDSTKEKIAKAKKIVGS
KQHLKAEKKLAEKAVTVLKNEQHTLPFKPKKGSRILIVAPYEEQTASIEQTIHDLIKRKK
IKPVSLSKMNFASQVFKTEHEKQVKEADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQAKPKGTLPVDIPSVTKPGNTLYPLGYGLNIKTGRPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctttccgcttatcctttcagccgttctctttctttcatgctttttcggg
gccagacagacagaagcctctgcatccaaacgtgcaatcgatgccaatcagattgtcaat
cgtatgtcgttagatgaaaaactcggccagatgctgatgcctgattttagaaattggcaa
aaggaaggcgagtcctctccgcaagcccttacaaaaatgaatgatgaagtcgccagcctc
gtcaagaaatatcaattcggaggcatcatcctttttgcagaaaatgtaaaaacaacaaaa
caaactgtccaactgacagacgattaccaaaaggcaagtccaaaaatcccgctcatgctg
agtattgatcaggaaggcggcattgtaacgaggttaggggagggcactaatttcccaggg
aatatggcgctgggcgcagccagaagcagaatcaatgcgtatcagaccggcagcatcatc
ggaaaagagctctctgccttaggcatcaatacagatttcagccctgtcgtggacattaac
aataatcctgataatcctgtaatcggcgtacggtcattcagctccaatcgagaactgaca
tcacgcctcggtttatatacgatgaaagggttgcagcggcaggatatcgcgtctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattatggactgccgctcgtt
tcccatggccaagaacggcttcgtgaggtcgagctttatccttttcaaaaagcaattgat
gctggtgctgatatggtgatgacagcccatgttcagtttcccgcctttgatgacaccact
tacaaaagcaaactcgatggatcggacattctggttccagctacactttcaaaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggggtcatcgttaccgatgcgctc
aatatgaaggcaatcgcagatcatttcggacaggaagaggctgtggtcatggccgtaaaa
gctggtgtcgatattgcattaatgccagcctcagtcacttcattgaaagaagaacagaaa
ttcgcacgtgttattcaagctttgaaagaagccgtgaaaaacggggatattcctgaacaa
caaatcaacaattcagttgaaagaatcatttccctgaaaataaaacgcggcatgtatcca
gcgcgaaacagcgacagtacaaaagaaaaaatagccaaagccaaaaaaatcgtaggaagc
aagcagcacctgaaagcagagaaaaaattagctgaaaaagcagtaactgtattaaaaaat
gaacagcacactttgccgttcaagcctaaaaaaggcagccgaatcttaattgtggcacct
tacgaagaacaaactgcttcaatcgaacaaaccattcacgatctcatcaagcgaaagaaa
atcaaacccgtatccctcagcaaaatgaactttgccagccaagtatttaagaccgagcat
gaaaaacaagtaaaagaggctgattatatcattaccggctcctatgtcgtcaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacacaatatcagattcaagcaaatgggccacc
gtgtttccgagagctgtcatgaaagccgcactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccctatgacgcagccaatttcgaagaagcaaaagcactgattgcagtc
tatggctttaaaggatacgcaaatggccgttatcttcaacctaatattccggccggagtg
atggcgatattcggccaggcaaaacctaaaggcacacttccagttgacattccgtcagtc
acgaaaccagggaacaccctttacccacttggctacggattaaatatcaaaacgggaaga
ccgctttaa

DBGET integrated database retrieval system