KEGG   Bacillus subtilis BEST7613: BEST7613_0261Help
Entry
BEST7613_0261     CDS       T02410                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsub00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsub00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bsub02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
284006..285757
Genome map
AA seq 583 aa AA seqDB search
MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTIAQSVGAFEVNAAPKF
SSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKWEVAKDEHFRKIVRKGT
EMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTLPAPGANVPQMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHNSAEIITLQDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRT
LLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGADKRADTD
QILKENPHIQFFNDYRGYVRCTVTPHQWKADYRVMPFVTEPGAAISTRASFVYQKDQTGL
RKVSSTTIQGGVKQSDEVEEDRFFSHNKAHEKQMIKKRAKITN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgacagtcgttttgatgaatgggtacagaaactgaaagaggaaagctttcaa
aacaatacgtttgaccgccgcaaatttattcaaggagcggggaagattgcaggactttct
cttggattaacgattgcccagtcggttggggcctttgaagtaaatgctgcgcctaaattc
tcaagctatccgtttacattaggggtagcgtcaggtgatccgctttctgacagtgtcgtg
ctttggacacgtctggcaccagatccgctgaatggcgggggaatgccgaagcaagcagtg
cctgtcaaatgggaggtcgcaaaggatgagcatttccgcaaaatcgtaagaaaaggcact
gaaatggctaaaccaagtcttgcccattccgttcatgtggaagcggacgggcttgagcca
aacaaagtgtactattaccgtttcaaaaccggccatgaactaagccctgtcggaaaaaca
aaaacactgcctgcccctggcgccaatgtgccgcaaatgacctttgcatttgcttcctgc
cagcaatatgagcacggatattatacggcctacaagcatatggcaaaggaaaagcttgat
cttgtcttccatctcggtgattacatatatgaatacggcccaaatgaatatgtatcaaaa
acaggcaatgtccgcacgcacaacagcgcggaaatcattacgctgcaagactatcggaac
cgtcacgctcaataccgttctgacgccaatcttaaagctgcacatgcggcattcccttgg
gttgtaacttgggatgaccatgaagttgaaaacaactatgccaataaaatacctgaaaaa
ggacagtcggttgaagcattcgtgctccgccgcgcggcagcataccaggcatactatgaa
catatgccgctccgcatttcctctttgccgaatggcccagatatgcagctgtaccggcac
tttacgtacggaaacctggcgtccttcaatgtgcttgatacccgccagtacagggacgac
caagccaataacgacggcaataagccgccttctgatgaatcgcgcaatccgaatcggact
ctgcttggaaaagaacaggagcagtggctcttcaacaatttgggcagctcgacagcccac
tggaatgtgctggcgcagcagattttctttgccaagtggaatttcgggacaagcgcaagc
ccgatctacagcatggattcgtgggacggctacccggctcagcgcgaacgggttatcaat
ttcattaaaagcaaaaatctgaataatgttgtcgtactgacaggtgatgtacacgcaagc
tgggcatcgaatttgcatgtcgatttcgagaagacaagttcaaaaatattcggagccgaa
tttgttggaacctcgatcacttccggagggaacggagcggataagcgagcggatacggac
caaattttaaaagaaaatccgcacatccagttctttaacgactatcgcggatatgtccgc
tgtacagtgacgcctcaccagtggaaagccgattatcgggtgatgccatttgtgaccgag
ccgggcgcagccatttccacgcgggcttcattcgtttaccagaaagaccaaaccgggttg
agaaaggtatcatccacaacaatccaaggcggggtgaagcaatccgatgaggtcgaagag
gatcgtttcttttcgcacaacaaagcccacgaaaaacaaatgattaagaagcgtgcaaaa
atcacgaattaa

DBGET integrated database retrieval system