KEGG   Bacillus subtilis BEST7613: BEST7613_0327Help
Entry
BEST7613_0327     CDS       T02410                                 

Gene name
nasF
Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bsub00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(353895..355340)
Genome map
AA seq 481 aa AA seqDB search
MKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKLLEFASPDCQFIYCGKLP
NRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGITS
GIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLARSVQTLVFYMGVKNLSY
ICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIVNF
QTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADLIEWPKWRTENMPVNEEILRKI
GTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQPDS
EKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLSVQ
QLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGFTAVQEQDELLAFIHNQHAEKKLLH
T
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggcctgctcacc
atcaaaggaaaacaggcgctcaaggaagcagatgtgattttatatgaccggctcgccaac
ccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaactgcca
aaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagcattaaat
gggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtcggcgag
gaagcagatgctcttcatgagcacggcattcgctatgaaatggtgccgggaatcacctct
ggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgcatcgtct
tttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttgactgggaa
gggctggcccgaagcgttcaaacccttgttttttacatgggtgtcaagaacttgtcttat
atttgccagcagcttatttcatacgggaaatcgccttctgtccctgtcattgtcatccaa
tggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcagcaaaaa
gtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtcaacttt
caaacacacagctggtttgaaagcaaaccgctcatcggacggcatttgatggttgtgact
catggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgatctcatc
gagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagaaattcttcgaaagatt
ggcacctttgaagacgtttttttcacatcgcgccgggcggtttgtgaatttttcagagca
ctggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagcatctgag
caagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcctgattca
gagaaacgtcttgttgtcgggagccgccatgcagtggaaaacatgcaaaagcatgaatcc
tgttcgttttatatcactcatgaaaacgtcatagatgaccggttcacccacatgattcag
cgtaccatcagtgaatccccgctgcacatggtcatttgcccaaacaagctgtccgttcag
caattgatcaatggtggcgaacaaattggcattttgccggaaccgtcagcaagccgccct
cctatcgtctgcataggcgatgactcagctgccggcatttatggattcacagccgtacaa
gaacaggatgaattgctagctttcatccacaatcaacatgcagagaaaaaactccttcac
acctga

DBGET integrated database retrieval system