KEGG   Bacillus subtilis BEST7613: BEST7613_0341Help
Entry
BEST7613_0341     CDS       T02410                                 

Gene name
bglC
Definition
aryl-phospho-beta-d-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsub00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
370254..371687
Genome map
AA seq 477 aa AA seqDB search
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVL
TLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIEAGDMDLLAKGKPDFVGVNY
YQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLRSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatccaccagcatccagaatcttttccgaaacattttttgtggggctctgcttctgca
gcgtaccagattgaaggcgcttggaatgaagatggcaaaggcccttctgtttgggatgtg
tttacgaaaataccgggcaaaacgtttaaaggaaccaatggcgagattgcggttgaccat
tatcaccgatttaaagaagatgtcgctctgatggctgagatggggttaaaagcatatcga
ttttccgtcagctggccacgggtttttccaaaaggaaaaggagagatcaatgaagcaggt
ctagcgttttacgatagtctgattgatgaattgctttctcatcacatcgagccggttctg
actttatatcactgggatttgcctcaagcgcttatggacgaatacggcgggtttgaatcc
agaaacatcatagaggattttaatcactactgtattactctttataaacgttttggagac
agggtgaaatattgggttacgttaaacgaacagaactacaattttaatcacggatttatt
acagccatgcatccgcctggagtgaaagacagaaaacgattttacgaagcaaaccatatt
gcgtttctggctaatgcaaaagccatcgaatcatttagagaatatgtgcctgaaggcaaa
ataggtcctagctttgcttattctccggcttaccctttatcaagtcatccagaggatata
ctggcatttgaaaacgccgaagaatttacgaacaattggtggcttgacatgtattgctgg
ggaacctacccgcaaattccattccgctgcttggaaaaacagggatgggcgccgacaatt
gaagcaggagatatggacctgctcgccaaagggaagcctgattttgtaggtgtcaattat
tatcagacgatcacctatgaacgaaatccgcttgatggtgtgtcagaagggaaaatgaat
acgacaggccaaaagggaaccaatcaggagacggggatacccggagtgttcaaaacgaaa
aaaaatccgcatctgacaacgagcaactgggattggacaattgacccaattgggctgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttataacagagaacggt
ttgggtgaatttgataaagttgaggacggcactgtacaggatgattatcgaattgattat
ttgcgttcgcatcttgagcaatgcagacaagccatcagtgacggtgtcgatttaatcggc
tattgcagctggtcgtttactgatctgttaagctggctgaacggctaccaaaaaagatac
ggatttgtatatgtcaatcgtgatgaagaaagcacatccgatttaaaacgcttgaagaaa
aaaagcttttattggtatcaagatgtcatcaagacaaacggagaaagtttataa

DBGET integrated database retrieval system