KEGG   Bacillus subtilis BEST7613: BEST7613_0572Help
Entry
BEST7613_0572     CDS       T02410                                 

Gene name
gmuD
Definition
mannoside-phospho-beta-d-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEST7613_0572 (gmuD)
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BEST7613_0572 (gmuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
607863..609260
Genome map
AA seq 465 aa AA seqDB search
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPF
VNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADV
KAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttggcacatacagaacaatatcgttttccaaaggatttttggtggggatcatccgcttca
gcaacacaaatggagggtgccgccgacagagacggaaaaggccagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcggacccgcagacacatcccaa
ttttacgacaactataaagaagatatcaggctgatgaaggaacttggccacaactcgttc
cggatgtcgatttcctggtcacgtttaataccaaacggaacgggcgagatcaacgataaa
gccgcagatttctataacaatgtcattgatgagctgatcgctaacggaattgaacctttt
gtcaatttgtttcatttcgatatgccgatggcgcttcaaaaaatcggcggctgggtcaac
agagagacggttgacgcgtatgaaaactatgcaagaacttgcttccgtttgtttggcggc
cgggtgaaaaaatggttcacgcataatgaaccaatcgttcccgtagaaggcggataccta
tatgattttcattatccaaacaaggtcgattttaaagaggccgtccaggttggatttcat
acgatgctatcaagtgcccgcgccattcaggcttacagggagatgaagcaggacggaaaa
atcggcatcatcttaaatttgaccccttcatacccgagaagcagccatccggcggatgtg
aaagccggggaaatcgcagacgcgttttttaacagatcttttttagacccatctgtcaaa
ggcgaatttcccaaagagctggttgacattttgaagcatgaaggctttatgcctgattac
aacgctgaagatctcgacatcatcaaaaagaacacggttgacctgttgggagtgaattat
taccagccgagacgtgtgaaagcgaaagaacatcttccgaatcccgacgctccttttttg
ccggacaggtattttgatccctacgtcatgccgggccgcaaaatgaatccgcatcgcggc
tgggagatctatgaaaaaggcgtttatgatattttgatcaatttaaaagaaaactacggc
aacatcgagtgttttatctctgaaaacggtatgggggttgaaggtgaagagcgattcagg
gatgaacaaggcatcattcaggatgattaccggattgaatttataaaagagcacctcaaa
tggattcaccgcgccatacaggaaggctcgaacgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacggatttgtatcagtcaat
cttgagaaagacggagaaagaaccgtcaaaaagagcggaaaatggttcaaagaggttgct
gagcatagcggtttctag

DBGET integrated database retrieval system