KEGG   Bacillus subtilis BEST7613: BEST7613_0621Help
Entry
BEST7613_0621     CDS       T02410                                 

Gene name
prpB
Definition
2-methylisocitrate lyase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bsub00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
663970..664857
Genome map
AA seq 295 aa AA seqDB search
MVKNRKSSIFRDALNSKGLVKVAGAHDGLSAKLAEKNGFNAVWASGLGISAVQTVPDASI
LTMTEFLEAAVIMNESCNLPVIADCDSGYGNIHNVTRMIKKYEAAGIAGVCIEDKVYPKL
NSFDDRQQILVSTEEFCAKIRAAKMAQQNDDFVLIARVEALIAKLGQEEAYTRAKAYVHA
GADAILIHSKEQSPDEIIEFVNNWDVDAPLVVVPTKYPTLSMEQLEKLGVKVSIYANQAL
RASVKAINDTFESIINNKSSLQIENDIVSVNEIFDIQDVPGMKQLERLIHRQPAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaacagaaaatcatcaatttttagagatgctttaaacagtaaaggtttggtg
aaagttgcgggagctcatgacggtttaagcgccaaattagcagagaaaaacggatttaat
gccgtatgggcaagcggtttgggaatctcggctgtgcaaactgtacctgatgccagtata
ttaacgatgactgaatttcttgaagccgccgtcattatgaatgaatcatgcaatttgccg
gtcatcgctgactgtgattccggctacgggaacattcacaatgtcacccgcatgatcaaa
aaatacgaagctgctggtattgccggagtttgtattgaagataaagtatatccaaaatta
aactcatttgacgacagacaacagatccttgtcagtactgaagaattttgcgcaaaaatt
agagccgcaaagatggctcagcaaaatgacgattttgtattgattgcccgtgtcgaagct
ttaattgctaaattgggtcaagaagaagcctatacaagagcaaaagcttatgttcatgct
ggagcagatgcaattttaattcattcaaaagaacaatcgcctgatgaaattattgagttt
gttaacaattgggacgtggatgcgccgttggttgtggttccgactaaatatccgacgctc
tcaatggaacagcttgagaaattgggagtgaaggtttccatctatgcgaatcaggcgttg
cgcgcttctgttaaggctataaatgatacattcgaaagcattataaataataaatcgtct
ttgcagattgaaaatgacatcgtgagcgttaatgagatatttgacattcaagacgttccg
gggatgaagcaactggagcgtttgatccatagacagccggctaactga

DBGET integrated database retrieval system