KEGG   Bacillus subtilis BEST7613: BEST7613_0705Help
Entry
BEST7613_0705     CDS       T02410                                 

Gene name
lplD
Definition
glycosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BEST7613_0705 (lplD)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BEST7613_0705 (lplD)
   00600 Sphingolipid metabolism
    BEST7613_0705 (lplD)
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BEST7613_0705 (lplD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
758190..759530
Genome map
AA seq 446 aa AA seqDB search
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNGRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGIEVPRREDIRVNVLGINHFTWITKASYRHIDLLPIFREFSAHYGESGY
ELEGECWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPIS
FRKQDRAEKRQETERLIVQQRGVAEKASGEEGVNIIAALLGLGELVTNVNMPNQGQVLNL
PIQAIVETNAFITRNRVQPILSGALPKGVEMLAARHISNQEAVADAGLTKDTGLAFQAFL
NDPLVQIDRSDAEQLFNDMLQCIMQS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatatcggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacggatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaacggcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgcg
gatatcgtcattatttccattttgccgggatcactggatgatatggaagtcgatgtgcac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcctggagggatc
atcaggggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggcatcaaagcgattggctgctgccacgaggtattcgggacgcaa
aagctattggcggaaatggtcacggaaaggctggggattgaggtgccgcggcgtgaggat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaaaagcctcttaccgc
catattgacctgttgcctatattccgtgaattcagcgcgcactatggggaatcaggatat
gagctggagggggaatgctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggcgccatccctgctgcgggtgacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaagtatggaaatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaagaaacagaacggttgatcgtgcaacaa
cggggcgttgctgagaaagcttcgggagaagaaggcgtgaacatcatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtcttaaacctt
cctatacaagccattgtcgaaacaaacgcattcatcacaaggaaccgtgtccagccgatt
ttgtccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatccaatcag
gaggcagtggcggacgcaggtttaacaaaggatactggcctcgcgtttcaagccttcctc
aatgacccgcttgtccagattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcatcatgcaaagctga

DBGET integrated database retrieval system