KEGG   Bacillus subtilis BEST7613: BEST7613_0999Help
Entry
BEST7613_0999     CDS       T02410                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BEST7613_0999 (hemY)
Enzymes [BR:bsub01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BEST7613_0999 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1063429..1064841
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgagctgacacttgtt
gaggcaagtccgagagtcggcgggaaaatccagactgtcaagaaagacggctatatcatc
gaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgttaaagac
ttaggtcttgagcatttgcttgtcaacaatgcgaccgggcaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggcgctgtaatggggataccgacaaaaattgcgccg
tttgtttctacgggtctgttttccttgtccgggaaggcgagagctgctatggatttcatc
ctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattcttccgcagacgtgtc
ggagatgaagtggtcgagaacttaatcgagccgctactatcagggatctacgcaggcgac
attgacaagctcagcctgatgtcgacatttccgcaattttatcagacggaacaaaagcat
agaagcctgattctcggcatgaaaaaaacaaggcctcaaggctcaggccagcagctgacg
gcaaaaaaacaagggcagttccaaactctgtcaaccggtttgcagacccttgtagaagag
atcgaaaagcagttaaagctgacgaaggtgtataaaggcacaaaagtgaccaaacttagc
catagcggctcttgctattcgctcgaactggataacggcgtcacacttgatgctgattca
gtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcctgccatt
tctcatttgaaaaatatgcactccacatccgtggcaaacgtcgctttaggtttccctgaa
ggctccgtccaaatggagcatgagggcacgggttttgtcatttcaagaaacagtgacttt
gcgatcacagcctgtacgtggacgaataaaaaatggccgcacgcagcgccggaaggcaaa
acgctgcttcgggcatatgtcggaaaagccggagacgaatccattgtcgatctatcagat
aatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaacggcgag
ccggaaatgacatgtgtaacccgatggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgtatcaaggagctgcgtgaagcacttgcatctgcgtatccgggtgtttatatg
acaggcgcttctttcgaaggtgtcggcattcccgactgcattgatcaaggaaaagctgcc
gtgtctgacgcgcttacctatttattcagctaa

DBGET integrated database retrieval system